Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 120 (31 Jul 2019)
Sequence version 2 (31 Oct 2006)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Uncharacterized protein C1orf159

Gene

C1orf159

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Uncharacterized protein C1orf159
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
ORF Names:UNQ2998/PRO9739
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 1

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:26062 C1orf159

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q96HA4

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei148 – 168HelicalSequence analysisAdd BLAST21

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

Open Targets

More...
OpenTargetsi
ENSG00000131591

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA142672410

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
C1orf159

Domain mapping of disease mutations (DMDM)

More...
DMDMi
119371554

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 18Sequence analysisAdd BLAST18
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000025525019 – 380Uncharacterized protein C1orf159Add BLAST362

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi104N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi111N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi128N-linked (GlcNAc...) asparagineSequence analysis1

Keywords - PTMi

Glycoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q96HA4

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q96HA4

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q96HA4

PeptideAtlas

More...
PeptideAtlasi
Q96HA4

PRoteomics IDEntifications database

More...
PRIDEi
Q96HA4

ProteomicsDB human proteome resource

More...
ProteomicsDBi
76718 [Q96HA4-1]
76719 [Q96HA4-2]
76720 [Q96HA4-3]
76721 [Q96HA4-4]
76722 [Q96HA4-5]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q96HA4

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q96HA4

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000131591 Expressed in 109 organ(s), highest expression level in right testis

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q96HA4 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q96HA4 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA010019

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
120325, 5 interactors

Protein interaction database and analysis system

More...
IntActi
Q96HA4, 2 interactors

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q96HA4

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi229 – 291Pro-richAdd BLAST63

Keywords - Domaini

Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IY0B Eukaryota
ENOG4111QE9 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000009794

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000231900

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q96HA4

Identification of Orthologs from Complete Genome Data

More...
OMAi
GRIWLAP

Database of Orthologous Groups

More...
OrthoDBi
1286818at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q96HA4

TreeFam database of animal gene trees

More...
TreeFami
TF330740

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR027888 DUF4501

The PANTHER Classification System

More...
PANTHERi
PTHR16247 PTHR16247, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF14946 DUF4501, 2 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 5 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 9 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q96HA4-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MALRHLALLA GLLVGVASKS MENTVTRNST AVINTQAEGT LSPPGLSSLP
60 70 80 90 100
VVREWALTHT AQLPECCVDV VGVNASCPGA SLCGPGCYRR WNADGSASCV
110 120 130 140 150
RCGNGTLPAY NGSECRSFAG PGAPFPMNRS SGTPGRPHPG APRVAASLFL
160 170 180 190 200
GTFFISSGLI LSVAGFFYLK RSSKLPRACY RRNKAPALQP GEAAAMIPPP
210 220 230 240 250
QSSGNSSCRI PLWGFPSLGQ SQGALWVCPQ TGLPGSGSRP PLPGSPGDPP
260 270 280 290 300
TRQGQGRIWL VPPALDLSWI WPAPPARPPL IPVTSMLFPV PETWGLQERR
310 320 330 340 350
THHDRADPQY LLLLEVQLHP RTDAAGLRQA LLSSHRFSGA GSGGPKSQPV
360 370 380
RKPRYVRRER PLDRATDPAA FPGEARISNV
Note: Gene prediction based on EST data.
Length:380
Mass (Da):40,283
Last modified:October 31, 2006 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iD82F85CF3D903B81
GO
Isoform 2 (identifier: Q96HA4-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     25-60: Missing.
     185-221: APALQPGEAAAMIPPPQSSGNSSCRIPLWGFPSLGQS → GPAPAGSLPGRWSSQQFGPQAPALQPGEAVSNPHHPG
     222-380: Missing.

Note: No experimental confirmation available.
Show »
Length:185
Mass (Da):19,097
Checksum:i2488F40B8F1239C3
GO
Isoform 3 (identifier: Q96HA4-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     25-60: Missing.
     204-225: GNSSCRIPLWGFPSLGQSQGAL → DVGSAGKEDPPRQGRPPIPAPP
     226-380: Missing.

Note: No experimental confirmation available.
Show »
Length:189
Mass (Da):19,464
Checksum:iB442CB2A09470157
GO
Isoform 4 (identifier: Q96HA4-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     25-60: Missing.
     204-349: Missing.

Note: No experimental confirmation available.
Show »
Length:198
Mass (Da):20,820
Checksum:i734467FBB65598A9
GO
Isoform 5 (identifier: Q96HA4-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-126: Missing.

Note: No experimental confirmation available.
Show »
Length:254
Mass (Da):27,411
Checksum:i76175CE950FF64C1
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 9 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
Q5T2W7Q5T2W7_HUMAN
Uncharacterized protein C1orf159
C1orf159
223Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
Q5T2W9Q5T2W9_HUMAN
Uncharacterized protein C1orf159
C1orf159
344Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
B2REC4B2REC4_HUMAN
Uncharacterized protein C1orf159
C1orf159
57Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
J3KSJ6J3KSJ6_HUMAN
Uncharacterized protein C1orf159
C1orf159
86Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
J3QRL0J3QRL0_HUMAN
Uncharacterized protein C1orf159
C1orf159
103Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
B2REC5B2REC5_HUMAN
Uncharacterized protein C1orf159
C1orf159
64Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
J3QKM1J3QKM1_HUMAN
Uncharacterized protein C1orf159
C1orf159
111Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
J3KT48J3KT48_HUMAN
Uncharacterized protein C1orf159
C1orf159
98Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
J3QSF0J3QSF0_HUMAN
Uncharacterized protein C1orf159
C1orf159
14Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0212801 – 126Missing in isoform 5. 1 PublicationAdd BLAST126
Alternative sequenceiVSP_02128125 – 60Missing in isoform 2, isoform 3 and isoform 4. 3 PublicationsAdd BLAST36
Alternative sequenceiVSP_021282185 – 221APALQ…SLGQS → GPAPAGSLPGRWSSQQFGPQ APALQPGEAVSNPHHPG in isoform 2. 1 PublicationAdd BLAST37
Alternative sequenceiVSP_021283204 – 349Missing in isoform 4. 1 PublicationAdd BLAST146
Alternative sequenceiVSP_021284204 – 225GNSSC…SQGAL → DVGSAGKEDPPRQGRPPIPA PP in isoform 3. 1 PublicationAdd BLAST22
Alternative sequenceiVSP_021285222 – 380Missing in isoform 2. 1 PublicationAdd BLAST159
Alternative sequenceiVSP_021286226 – 380Missing in isoform 3. 1 PublicationAdd BLAST155

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AY358490 mRNA Translation: AAQ88854.1
AK000591 mRNA Translation: BAA91276.1
AK057368 mRNA Translation: BAG51908.1
AK128434 mRNA Translation: BAC87438.1
AL390719 Genomic DNA No translation available.
BC008788 mRNA Translation: AAH08788.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS7.2 [Q96HA4-4]
CCDS81250.1 [Q96HA4-1]

NCBI Reference Sequences

More...
RefSeqi
NP_001317235.1, NM_001330306.1 [Q96HA4-1]
NP_060361.4, NM_017891.4 [Q96HA4-4]
XP_011539963.1, XM_011541661.2 [Q96HA4-1]
XP_011539964.1, XM_011541662.2 [Q96HA4-1]
XP_016857065.1, XM_017001576.1 [Q96HA4-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000379319; ENSP00000368623; ENSG00000131591 [Q96HA4-4]
ENST00000379325; ENSP00000368629; ENSG00000131591 [Q96HA4-3]
ENST00000379339; ENSP00000368644; ENSG00000131591 [Q96HA4-1]
ENST00000421241; ENSP00000400736; ENSG00000131591 [Q96HA4-4]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
54991

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:54991

UCSC genome browser

More...
UCSCi
uc001act.3 human [Q96HA4-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY358490 mRNA Translation: AAQ88854.1
AK000591 mRNA Translation: BAA91276.1
AK057368 mRNA Translation: BAG51908.1
AK128434 mRNA Translation: BAC87438.1
AL390719 Genomic DNA No translation available.
BC008788 mRNA Translation: AAH08788.1
CCDSiCCDS7.2 [Q96HA4-4]
CCDS81250.1 [Q96HA4-1]
RefSeqiNP_001317235.1, NM_001330306.1 [Q96HA4-1]
NP_060361.4, NM_017891.4 [Q96HA4-4]
XP_011539963.1, XM_011541661.2 [Q96HA4-1]
XP_011539964.1, XM_011541662.2 [Q96HA4-1]
XP_016857065.1, XM_017001576.1 [Q96HA4-1]

3D structure databases

SMRiQ96HA4
ModBaseiSearch...

Protein-protein interaction databases

BioGridi120325, 5 interactors
IntActiQ96HA4, 2 interactors

PTM databases

iPTMnetiQ96HA4
PhosphoSitePlusiQ96HA4

Polymorphism and mutation databases

BioMutaiC1orf159
DMDMi119371554

Proteomic databases

EPDiQ96HA4
MaxQBiQ96HA4
PaxDbiQ96HA4
PeptideAtlasiQ96HA4
PRIDEiQ96HA4
ProteomicsDBi76718 [Q96HA4-1]
76719 [Q96HA4-2]
76720 [Q96HA4-3]
76721 [Q96HA4-4]
76722 [Q96HA4-5]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
54991
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000379319; ENSP00000368623; ENSG00000131591 [Q96HA4-4]
ENST00000379325; ENSP00000368629; ENSG00000131591 [Q96HA4-3]
ENST00000379339; ENSP00000368644; ENSG00000131591 [Q96HA4-1]
ENST00000421241; ENSP00000400736; ENSG00000131591 [Q96HA4-4]
GeneIDi54991
KEGGihsa:54991
UCSCiuc001act.3 human [Q96HA4-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
54991

GeneCards: human genes, protein and diseases

More...
GeneCardsi
C1orf159
HGNCiHGNC:26062 C1orf159
HPAiHPA010019
neXtProtiNX_Q96HA4
OpenTargetsiENSG00000131591
PharmGKBiPA142672410

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410IY0B Eukaryota
ENOG4111QE9 LUCA
GeneTreeiENSGT00390000009794
HOGENOMiHOG000231900
InParanoidiQ96HA4
OMAiGRIWLAP
OrthoDBi1286818at2759
PhylomeDBiQ96HA4
TreeFamiTF330740

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
C1orf159 human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
54991

Protein Ontology

More...
PROi
PR:Q96HA4

Gene expression databases

BgeeiENSG00000131591 Expressed in 109 organ(s), highest expression level in right testis
ExpressionAtlasiQ96HA4 baseline and differential
GenevisibleiQ96HA4 HS

Family and domain databases

InterProiView protein in InterPro
IPR027888 DUF4501
PANTHERiPTHR16247 PTHR16247, 1 hit
PfamiView protein in Pfam
PF14946 DUF4501, 2 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiCA159_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q96HA4
Secondary accession number(s): B3KQ46
, Q5T2W6, Q6UX67, Q6ZR77, Q9NWV0
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 31, 2006
Last sequence update: October 31, 2006
Last modified: July 31, 2019
This is version 120 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again