Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Uncharacterized protein C1orf159

Gene

C1orf159

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at transcript leveli

Names & Taxonomyi

Protein namesi
Recommended name:
Uncharacterized protein C1orf159
Gene namesi
ORF Names:UNQ2998/PRO9739
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 1

Organism-specific databases

EuPathDBiHostDB:ENSG00000131591.17
HGNCiHGNC:26062 C1orf159
neXtProtiNX_Q96HA4

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Transmembranei148 – 168HelicalSequence analysisAdd BLAST21

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000131591
PharmGKBiPA142672410

Polymorphism and mutation databases

DMDMi119371554

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 18Sequence analysisAdd BLAST18
ChainiPRO_000025525019 – 380Uncharacterized protein C1orf159Add BLAST362

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi104N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi111N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi128N-linked (GlcNAc...) asparagineSequence analysis1

Keywords - PTMi

Glycoprotein

Proteomic databases

EPDiQ96HA4
MaxQBiQ96HA4
PaxDbiQ96HA4
PeptideAtlasiQ96HA4
PRIDEiQ96HA4
ProteomicsDBi76718
76719 [Q96HA4-2]
76720 [Q96HA4-3]
76721 [Q96HA4-4]
76722 [Q96HA4-5]

PTM databases

iPTMnetiQ96HA4
PhosphoSitePlusiQ96HA4

Expressioni

Gene expression databases

BgeeiENSG00000131591 Expressed in 109 organ(s), highest expression level in right testis
CleanExiHS_C1orf159
ExpressionAtlasiQ96HA4 baseline and differential
GenevisibleiQ96HA4 HS

Organism-specific databases

HPAiHPA010019

Interactioni

Protein-protein interaction databases

BioGridi120325, 5 interactors
IntActiQ96HA4, 2 interactors
STRINGi9606.ENSP00000368623

Structurei

3D structure databases

ProteinModelPortaliQ96HA4
SMRiQ96HA4
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi229 – 291Pro-richAdd BLAST63

Keywords - Domaini

Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiENOG410IY0B Eukaryota
ENOG4111QE9 LUCA
GeneTreeiENSGT00390000009794
HOGENOMiHOG000231900
HOVERGENiHBG058261
InParanoidiQ96HA4
OMAiGRIWLAP
OrthoDBiEOG091G17WA
PhylomeDBiQ96HA4
TreeFamiTF330740

Family and domain databases

InterProiView protein in InterPro
IPR027888 DUF4501
PANTHERiPTHR16247 PTHR16247, 1 hit
PfamiView protein in Pfam
PF14946 DUF4501, 2 hits

Sequences (5+)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 9 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q96HA4-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MALRHLALLA GLLVGVASKS MENTVTRNST AVINTQAEGT LSPPGLSSLP
60 70 80 90 100
VVREWALTHT AQLPECCVDV VGVNASCPGA SLCGPGCYRR WNADGSASCV
110 120 130 140 150
RCGNGTLPAY NGSECRSFAG PGAPFPMNRS SGTPGRPHPG APRVAASLFL
160 170 180 190 200
GTFFISSGLI LSVAGFFYLK RSSKLPRACY RRNKAPALQP GEAAAMIPPP
210 220 230 240 250
QSSGNSSCRI PLWGFPSLGQ SQGALWVCPQ TGLPGSGSRP PLPGSPGDPP
260 270 280 290 300
TRQGQGRIWL VPPALDLSWI WPAPPARPPL IPVTSMLFPV PETWGLQERR
310 320 330 340 350
THHDRADPQY LLLLEVQLHP RTDAAGLRQA LLSSHRFSGA GSGGPKSQPV
360 370 380
RKPRYVRRER PLDRATDPAA FPGEARISNV
Note: Gene prediction based on EST data.
Length:380
Mass (Da):40,283
Last modified:October 31, 2006 - v2
Checksum:iD82F85CF3D903B81
GO
Isoform 2 (identifier: Q96HA4-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     25-60: Missing.
     185-221: APALQPGEAAAMIPPPQSSGNSSCRIPLWGFPSLGQS → GPAPAGSLPGRWSSQQFGPQAPALQPGEAVSNPHHPG
     222-380: Missing.

Note: No experimental confirmation available.
Show »
Length:185
Mass (Da):19,097
Checksum:i2488F40B8F1239C3
GO
Isoform 3 (identifier: Q96HA4-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     25-60: Missing.
     204-225: GNSSCRIPLWGFPSLGQSQGAL → DVGSAGKEDPPRQGRPPIPAPP
     226-380: Missing.

Note: No experimental confirmation available.
Show »
Length:189
Mass (Da):19,464
Checksum:iB442CB2A09470157
GO
Isoform 4 (identifier: Q96HA4-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     25-60: Missing.
     204-349: Missing.

Note: No experimental confirmation available.
Show »
Length:198
Mass (Da):20,820
Checksum:i734467FBB65598A9
GO
Isoform 5 (identifier: Q96HA4-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-126: Missing.

Note: No experimental confirmation available.
Show »
Length:254
Mass (Da):27,411
Checksum:i76175CE950FF64C1
GO

Computationally mapped potential isoform sequencesi

There are 9 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
Q5T2W9Q5T2W9_HUMAN
Uncharacterized protein C1orf159
C1orf159
344Annotation score:
Q5T2W7Q5T2W7_HUMAN
Uncharacterized protein C1orf159
C1orf159
223Annotation score:
J3QRL0J3QRL0_HUMAN
Uncharacterized protein C1orf159
C1orf159
103Annotation score:
J3KSJ6J3KSJ6_HUMAN
Uncharacterized protein C1orf159
C1orf159
86Annotation score:
B2REC4B2REC4_HUMAN
Uncharacterized protein C1orf159
C1orf159
57Annotation score:
J3QKM1J3QKM1_HUMAN
Uncharacterized protein C1orf159
C1orf159
111Annotation score:
B2REC5B2REC5_HUMAN
Uncharacterized protein C1orf159
C1orf159
64Annotation score:
J3KT48J3KT48_HUMAN
Uncharacterized protein C1orf159
C1orf159
98Annotation score:
J3QSF0J3QSF0_HUMAN
Uncharacterized protein C1orf159
C1orf159
14Annotation score:

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0212801 – 126Missing in isoform 5. 1 PublicationAdd BLAST126
Alternative sequenceiVSP_02128125 – 60Missing in isoform 2, isoform 3 and isoform 4. 3 PublicationsAdd BLAST36
Alternative sequenceiVSP_021282185 – 221APALQ…SLGQS → GPAPAGSLPGRWSSQQFGPQ APALQPGEAVSNPHHPG in isoform 2. 1 PublicationAdd BLAST37
Alternative sequenceiVSP_021283204 – 349Missing in isoform 4. 1 PublicationAdd BLAST146
Alternative sequenceiVSP_021284204 – 225GNSSC…SQGAL → DVGSAGKEDPPRQGRPPIPA PP in isoform 3. 1 PublicationAdd BLAST22
Alternative sequenceiVSP_021285222 – 380Missing in isoform 2. 1 PublicationAdd BLAST159
Alternative sequenceiVSP_021286226 – 380Missing in isoform 3. 1 PublicationAdd BLAST155

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY358490 mRNA Translation: AAQ88854.1
AK000591 mRNA Translation: BAA91276.1
AK057368 mRNA Translation: BAG51908.1
AK128434 mRNA Translation: BAC87438.1
AL390719 Genomic DNA No translation available.
BC008788 mRNA Translation: AAH08788.1
CCDSiCCDS7.2 [Q96HA4-4]
CCDS81250.1 [Q96HA4-1]
RefSeqiNP_001317235.1, NM_001330306.1 [Q96HA4-1]
NP_060361.4, NM_017891.4 [Q96HA4-4]
XP_011539963.1, XM_011541661.2 [Q96HA4-1]
XP_011539964.1, XM_011541662.2 [Q96HA4-1]
XP_016857065.1, XM_017001576.1 [Q96HA4-1]
UniGeneiHs.235095

Genome annotation databases

EnsembliENST00000379319; ENSP00000368623; ENSG00000131591 [Q96HA4-4]
ENST00000379325; ENSP00000368629; ENSG00000131591 [Q96HA4-3]
ENST00000379339; ENSP00000368644; ENSG00000131591 [Q96HA4-1]
ENST00000421241; ENSP00000400736; ENSG00000131591 [Q96HA4-4]
GeneIDi54991
KEGGihsa:54991
UCSCiuc001act.3 human [Q96HA4-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY358490 mRNA Translation: AAQ88854.1
AK000591 mRNA Translation: BAA91276.1
AK057368 mRNA Translation: BAG51908.1
AK128434 mRNA Translation: BAC87438.1
AL390719 Genomic DNA No translation available.
BC008788 mRNA Translation: AAH08788.1
CCDSiCCDS7.2 [Q96HA4-4]
CCDS81250.1 [Q96HA4-1]
RefSeqiNP_001317235.1, NM_001330306.1 [Q96HA4-1]
NP_060361.4, NM_017891.4 [Q96HA4-4]
XP_011539963.1, XM_011541661.2 [Q96HA4-1]
XP_011539964.1, XM_011541662.2 [Q96HA4-1]
XP_016857065.1, XM_017001576.1 [Q96HA4-1]
UniGeneiHs.235095

3D structure databases

ProteinModelPortaliQ96HA4
SMRiQ96HA4
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi120325, 5 interactors
IntActiQ96HA4, 2 interactors
STRINGi9606.ENSP00000368623

PTM databases

iPTMnetiQ96HA4
PhosphoSitePlusiQ96HA4

Polymorphism and mutation databases

DMDMi119371554

Proteomic databases

EPDiQ96HA4
MaxQBiQ96HA4
PaxDbiQ96HA4
PeptideAtlasiQ96HA4
PRIDEiQ96HA4
ProteomicsDBi76718
76719 [Q96HA4-2]
76720 [Q96HA4-3]
76721 [Q96HA4-4]
76722 [Q96HA4-5]

Protocols and materials databases

DNASUi54991
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000379319; ENSP00000368623; ENSG00000131591 [Q96HA4-4]
ENST00000379325; ENSP00000368629; ENSG00000131591 [Q96HA4-3]
ENST00000379339; ENSP00000368644; ENSG00000131591 [Q96HA4-1]
ENST00000421241; ENSP00000400736; ENSG00000131591 [Q96HA4-4]
GeneIDi54991
KEGGihsa:54991
UCSCiuc001act.3 human [Q96HA4-1]

Organism-specific databases

CTDi54991
EuPathDBiHostDB:ENSG00000131591.17
GeneCardsiC1orf159
H-InvDBiHIX0000013
HGNCiHGNC:26062 C1orf159
HPAiHPA010019
neXtProtiNX_Q96HA4
OpenTargetsiENSG00000131591
PharmGKBiPA142672410
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IY0B Eukaryota
ENOG4111QE9 LUCA
GeneTreeiENSGT00390000009794
HOGENOMiHOG000231900
HOVERGENiHBG058261
InParanoidiQ96HA4
OMAiGRIWLAP
OrthoDBiEOG091G17WA
PhylomeDBiQ96HA4
TreeFamiTF330740

Miscellaneous databases

ChiTaRSiC1orf159 human
GenomeRNAii54991
PROiPR:Q96HA4

Gene expression databases

BgeeiENSG00000131591 Expressed in 109 organ(s), highest expression level in right testis
CleanExiHS_C1orf159
ExpressionAtlasiQ96HA4 baseline and differential
GenevisibleiQ96HA4 HS

Family and domain databases

InterProiView protein in InterPro
IPR027888 DUF4501
PANTHERiPTHR16247 PTHR16247, 1 hit
PfamiView protein in Pfam
PF14946 DUF4501, 2 hits
ProtoNetiSearch...

Entry informationi

Entry nameiCA159_HUMAN
AccessioniPrimary (citable) accession number: Q96HA4
Secondary accession number(s): B3KQ46
, Q5T2W6, Q6UX67, Q6ZR77, Q9NWV0
Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 31, 2006
Last sequence update: October 31, 2006
Last modified: November 7, 2018
This is version 115 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again