Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Centromere protein N

Gene

CENPN

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Component of the CENPA-NAC (nucleosome-associated) complex, a complex that plays a central role in assembly of kinetochore proteins, mitotic progression and chromosome segregation. The CENPA-NAC complex recruits the CENPA-CAD (nucleosome distal) complex and may be involved in incorporation of newly synthesized CENPA into centromeres. CENPN is the first protein to bind specifically to CENPA nucleosomes and the direct binding of CENPA nucleosomes by CENPN is required for centromere assembly. Required for chromosome congression and efficiently align the chromosomes on a metaphase plate.4 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Biological processi

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-141444 Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal
R-HSA-2467813 Separation of Sister Chromatids
R-HSA-2500257 Resolution of Sister Chromatid Cohesion
R-HSA-5663220 RHO GTPases Activate Formins
R-HSA-606279 Deposition of new CENPA-containing nucleosomes at the centromere
R-HSA-68877 Mitotic Prometaphase

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Centromere protein N
Short name:
CENP-N
Alternative name(s):
Interphase centromere complex protein 32
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:CENPN
Synonyms:C16orf60, ICEN32
ORF Names:BM-309
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 16

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000166451.13

Human Gene Nomenclature Database

More...
HGNCi
HGNC:30873 CENPN

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
611509 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q96H22

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Centromere, Chromosome, Kinetochore, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi11R → A: Decreases the binding to centromeres. 1 Publication1
Mutagenesisi196R → A: Decreases the binding to centromeres. 1 Publication1

Organism-specific databases

Open Targets

More...
OpenTargetsi
ENSG00000166451

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA143485397

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
CENPN

Domain mapping of disease mutations (DMDM)

More...
DMDMi
308153423

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002494941 – 339Centromere protein NAdd BLAST339

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei226PhosphoserineCombined sources1
Modified residuei235PhosphoserineCombined sources1
Modified residuei282PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q96H22

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q96H22

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q96H22

PeptideAtlas

More...
PeptideAtlasi
Q96H22

PRoteomics IDEntifications database

More...
PRIDEi
Q96H22

ProteomicsDB human proteome resource

More...
ProteomicsDBi
76697
76698 [Q96H22-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q96H22

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q96H22

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000166451 Expressed in 163 organ(s), highest expression level in material anatomical entity

CleanEx database of gene expression profiles

More...
CleanExi
HS_CENPN

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q96H22 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q96H22 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA052870

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Component of the CENPA-NAC complex, at least composed of CENPA, CENPC, CENPH, CENPM, CENPN, CENPT and CENPU (PubMed:16622420, PubMed:16622419). The CENPA-NAC complex interacts with the CENPA-CAD complex, composed of CENPI, CENPK, CENPL, CENPO, CENPP, CENPQ, CENPR and CENPS. Interacts directly with CENPA (PubMed:19543270). Identified in a centromere complex containing histones H2A, H2B and H4, and at least CENPA, CENPB, CENPC, CENPT, CENPN, HJURP, SUPT16H, SSRP1 and RSF1 (PubMed:27499292).4 Publications

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
120942, 28 interactors

CORUM comprehensive resource of mammalian protein complexes

More...
CORUMi
Q96H22

Protein interaction database and analysis system

More...
IntActi
Q96H22, 10 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000377007

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1339
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q96H22

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the CENP-N/CHL4 family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IKJC Eukaryota
ENOG4111H2Z LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000004738

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000015409

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG058868

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q96H22

KEGG Orthology (KO)

More...
KOi
K11506

Identification of Orthologs from Complete Genome Data

More...
OMAi
LTVASKH

Database of Orthologous Groups

More...
OrthoDBi
EOG091G0YMK

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q96H22

TreeFam database of animal gene trees

More...
TreeFami
TF329714

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR007902 Chl4/mis15/CENP-N

The PANTHER Classification System

More...
PANTHERi
PTHR12309:SF12 PTHR12309:SF12, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF05238 CENP-N, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 5 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q96H22-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MDETVAEFIK RTILKIPMNE LTTILKAWDF LSENQLQTVN FRQRKESVVQ
60 70 80 90 100
HLIHLCEEKR ASISDAALLD IIYMQFHQHQ KVWEVFQMSK GPGEDVDLFD
110 120 130 140 150
MKQFKNSFKK ILQRALKNVT VSFRETEENA VWIRIAWGTQ YTKPNQYKPT
160 170 180 190 200
YVVYYSQTPY AFTSSSMLRR NTPLLGQALT IASKHHQIVK MDLRSRYLDS
210 220 230 240 250
LKAIVFKQYN QTFETHNSTT PLQERSLGLD INMDSRIIHE NIVEKERVQR
260 270 280 290 300
ITQETFGDYP QPQLEFAQYK LETKFKSGLN GSILAEREEP LRCLIKFSSP
310 320 330
HLLEALKSLA PAGIADAPLS PLLTCIPNKR MNYFKIRDK
Length:339
Mass (Da):39,555
Last modified:October 5, 2010 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i7A0D3326032DE99B
GO
Isoform 2 (identifier: Q96H22-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     178-204: ALTIASKHHQIVKMDLRSRYLDSLKAI → ELEATGKIYLRQEEIILDITEMKKACN
     205-339: Missing.

Show »
Length:204
Mass (Da):24,067
Checksum:i3954E4F78E020360
GO
Isoform 3 (identifier: Q96H22-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     313-339: GIADAPLSPLLTCIPNKRMNYFKIRDK → ALVCRIQKLLCYSGSHSQGTQDPSSWQKDLYLLFVPLYPRC

Note: No experimental confirmation available.
Show »
Length:353
Mass (Da):41,194
Checksum:iB3366A33C89CD296
GO
Isoform 4 (identifier: Q96H22-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     73-93: YMQFHQHQKVWEVFQMSKGPG → C

Note: No experimental confirmation available.
Show »
Length:319
Mass (Da):37,083
Checksum:i52873DA13A654ED2
GO
Isoform 5 (identifier: Q96H22-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     177-210: Missing.

Note: No experimental confirmation available.
Show »
Length:305
Mass (Da):35,556
Checksum:i5D7E6CFAB91045CD
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H3BMC7H3BMC7_HUMAN
Centromere protein N
CENPN
177Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H3BMD5H3BMD5_HUMAN
Centromere protein N
CENPN
76Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H3BRU7H3BRU7_HUMAN
Centromere protein N
CENPN
105Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti139T → A in AK026313 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_02741984E → D4 PublicationsCorresponds to variant dbSNP:rs935939Ensembl.1
Natural variantiVAR_048689223Q → R. Corresponds to variant dbSNP:rs11641523Ensembl.1
Natural variantiVAR_048690288E → K1 PublicationCorresponds to variant dbSNP:rs2549887Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_04468973 – 93YMQFH…SKGPG → C in isoform 4. 1 PublicationAdd BLAST21
Alternative sequenceiVSP_044690177 – 210Missing in isoform 5. 1 PublicationAdd BLAST34
Alternative sequenceiVSP_020441178 – 204ALTIA…SLKAI → ELEATGKIYLRQEEIILDIT EMKKACN in isoform 2. 2 PublicationsAdd BLAST27
Alternative sequenceiVSP_020442205 – 339Missing in isoform 2. 2 PublicationsAdd BLAST135
Alternative sequenceiVSP_044565313 – 339GIADA…KIRDK → ALVCRIQKLLCYSGSHSQGT QDPSSWQKDLYLLFVPLYPR C in isoform 3. 1 PublicationAdd BLAST27

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF217515 mRNA Translation: AAF67626.1
AK023669 mRNA Translation: BAG51215.1
AK026313 mRNA No translation available.
AK298554 mRNA Translation: BAG60749.1
AK296024 mRNA Translation: BAG58793.1
AC092718 Genomic DNA No translation available.
CH471114 Genomic DNA Translation: EAW95553.1
CH471114 Genomic DNA Translation: EAW95556.1
BC007334 mRNA Translation: AAH07334.1
BC008972 mRNA Translation: AAH08972.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS10931.1 [Q96H22-2]
CCDS42199.1 [Q96H22-3]
CCDS42200.1 [Q96H22-1]
CCDS58482.1 [Q96H22-5]
CCDS58483.1 [Q96H22-4]

NCBI Reference Sequences

More...
RefSeqi
NP_001094094.2, NM_001100624.2 [Q96H22-1]
NP_001094095.2, NM_001100625.2 [Q96H22-3]
NP_001257402.1, NM_001270473.1 [Q96H22-4]
NP_001257403.1, NM_001270474.1 [Q96H22-5]
NP_060925.2, NM_018455.5 [Q96H22-2]
XP_006721299.1, XM_006721236.3 [Q96H22-1]
XP_016878945.1, XM_017023456.1 [Q96H22-2]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.726537

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000299572; ENSP00000299572; ENSG00000166451 [Q96H22-2]
ENST00000305850; ENSP00000305608; ENSG00000166451 [Q96H22-1]
ENST00000393335; ENSP00000377007; ENSG00000166451 [Q96H22-3]
ENST00000428963; ENSP00000393991; ENSG00000166451 [Q96H22-5]
ENST00000439957; ENSP00000395235; ENSG00000166451 [Q96H22-4]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
55839

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:55839

UCSC genome browser

More...
UCSCi
uc002ffw.5 human [Q96H22-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF217515 mRNA Translation: AAF67626.1
AK023669 mRNA Translation: BAG51215.1
AK026313 mRNA No translation available.
AK298554 mRNA Translation: BAG60749.1
AK296024 mRNA Translation: BAG58793.1
AC092718 Genomic DNA No translation available.
CH471114 Genomic DNA Translation: EAW95553.1
CH471114 Genomic DNA Translation: EAW95556.1
BC007334 mRNA Translation: AAH07334.1
BC008972 mRNA Translation: AAH08972.1
CCDSiCCDS10931.1 [Q96H22-2]
CCDS42199.1 [Q96H22-3]
CCDS42200.1 [Q96H22-1]
CCDS58482.1 [Q96H22-5]
CCDS58483.1 [Q96H22-4]
RefSeqiNP_001094094.2, NM_001100624.2 [Q96H22-1]
NP_001094095.2, NM_001100625.2 [Q96H22-3]
NP_001257402.1, NM_001270473.1 [Q96H22-4]
NP_001257403.1, NM_001270474.1 [Q96H22-5]
NP_060925.2, NM_018455.5 [Q96H22-2]
XP_006721299.1, XM_006721236.3 [Q96H22-1]
XP_016878945.1, XM_017023456.1 [Q96H22-2]
UniGeneiHs.726537

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
6BUZelectron microscopy3.92N1-286[»]
6C0Welectron microscopy4.00K1-289[»]
6EQTX-ray2.73A/B1-213[»]
SMRiQ96H22
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi120942, 28 interactors
CORUMiQ96H22
IntActiQ96H22, 10 interactors
STRINGi9606.ENSP00000377007

PTM databases

iPTMnetiQ96H22
PhosphoSitePlusiQ96H22

Polymorphism and mutation databases

BioMutaiCENPN
DMDMi308153423

Proteomic databases

EPDiQ96H22
MaxQBiQ96H22
PaxDbiQ96H22
PeptideAtlasiQ96H22
PRIDEiQ96H22
ProteomicsDBi76697
76698 [Q96H22-2]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000299572; ENSP00000299572; ENSG00000166451 [Q96H22-2]
ENST00000305850; ENSP00000305608; ENSG00000166451 [Q96H22-1]
ENST00000393335; ENSP00000377007; ENSG00000166451 [Q96H22-3]
ENST00000428963; ENSP00000393991; ENSG00000166451 [Q96H22-5]
ENST00000439957; ENSP00000395235; ENSG00000166451 [Q96H22-4]
GeneIDi55839
KEGGihsa:55839
UCSCiuc002ffw.5 human [Q96H22-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
55839
EuPathDBiHostDB:ENSG00000166451.13

GeneCards: human genes, protein and diseases

More...
GeneCardsi
CENPN
HGNCiHGNC:30873 CENPN
HPAiHPA052870
MIMi611509 gene
neXtProtiNX_Q96H22
OpenTargetsiENSG00000166451
PharmGKBiPA143485397

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410IKJC Eukaryota
ENOG4111H2Z LUCA
GeneTreeiENSGT00390000004738
HOGENOMiHOG000015409
HOVERGENiHBG058868
InParanoidiQ96H22
KOiK11506
OMAiLTVASKH
OrthoDBiEOG091G0YMK
PhylomeDBiQ96H22
TreeFamiTF329714

Enzyme and pathway databases

ReactomeiR-HSA-141444 Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal
R-HSA-2467813 Separation of Sister Chromatids
R-HSA-2500257 Resolution of Sister Chromatid Cohesion
R-HSA-5663220 RHO GTPases Activate Formins
R-HSA-606279 Deposition of new CENPA-containing nucleosomes at the centromere
R-HSA-68877 Mitotic Prometaphase

Miscellaneous databases

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
CENPN

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
55839

Protein Ontology

More...
PROi
PR:Q96H22

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000166451 Expressed in 163 organ(s), highest expression level in material anatomical entity
CleanExiHS_CENPN
ExpressionAtlasiQ96H22 baseline and differential
GenevisibleiQ96H22 HS

Family and domain databases

InterProiView protein in InterPro
IPR007902 Chl4/mis15/CENP-N
PANTHERiPTHR12309:SF12 PTHR12309:SF12, 1 hit
PfamiView protein in Pfam
PF05238 CENP-N, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiCENPN_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q96H22
Secondary accession number(s): A8MZE6
, B3KN53, B4DJD1, B4DPY7, C9JJM5, D3DUK8, E7ES30, E7ETS3, Q9NZ83
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: September 19, 2006
Last sequence update: October 5, 2010
Last modified: November 7, 2018
This is version 136 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. SIMILARITY comments
    Index of protein domains and families
  3. Human chromosome 16
    Human chromosome 16: entries, gene names and cross-references to MIM
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  6. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again