Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Centromere protein N

Gene

CENPN

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Component of the CENPA-NAC (nucleosome-associated) complex, a complex that plays a central role in assembly of kinetochore proteins, mitotic progression and chromosome segregation. The CENPA-NAC complex recruits the CENPA-CAD (nucleosome distal) complex and may be involved in incorporation of newly synthesized CENPA into centromeres. CENPN is the first protein to bind specifically to CENPA nucleosomes and the direct binding of CENPA nucleosomes by CENPN is required for centromere assembly. Required for chromosome congression and efficiently align the chromosomes on a metaphase plate.4 Publications

GO - Biological processi

Enzyme and pathway databases

ReactomeiR-HSA-141444 Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal
R-HSA-2467813 Separation of Sister Chromatids
R-HSA-2500257 Resolution of Sister Chromatid Cohesion
R-HSA-5663220 RHO GTPases Activate Formins
R-HSA-606279 Deposition of new CENPA-containing nucleosomes at the centromere
R-HSA-68877 Mitotic Prometaphase

Names & Taxonomyi

Protein namesi
Recommended name:
Centromere protein N
Short name:
CENP-N
Alternative name(s):
Interphase centromere complex protein 32
Gene namesi
Name:CENPN
Synonyms:C16orf60, ICEN32
ORF Names:BM-309
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 16

Organism-specific databases

EuPathDBiHostDB:ENSG00000166451.13
HGNCiHGNC:30873 CENPN
MIMi611509 gene
neXtProtiNX_Q96H22

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Centromere, Chromosome, Kinetochore, Nucleus

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi11R → A: Decreases the binding to centromeres. 1 Publication1
Mutagenesisi196R → A: Decreases the binding to centromeres. 1 Publication1

Organism-specific databases

OpenTargetsiENSG00000166451
PharmGKBiPA143485397

Polymorphism and mutation databases

BioMutaiCENPN
DMDMi308153423

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002494941 – 339Centromere protein NAdd BLAST339

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei226PhosphoserineCombined sources1
Modified residuei235PhosphoserineCombined sources1
Modified residuei282PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ96H22
MaxQBiQ96H22
PaxDbiQ96H22
PeptideAtlasiQ96H22
PRIDEiQ96H22
ProteomicsDBi76697
76698 [Q96H22-2]

PTM databases

iPTMnetiQ96H22
PhosphoSitePlusiQ96H22

Expressioni

Gene expression databases

BgeeiENSG00000166451 Expressed in 163 organ(s), highest expression level in material anatomical entity
CleanExiHS_CENPN
ExpressionAtlasiQ96H22 baseline and differential
GenevisibleiQ96H22 HS

Organism-specific databases

HPAiHPA052870

Interactioni

Subunit structurei

Component of the CENPA-NAC complex, at least composed of CENPA, CENPC, CENPH, CENPM, CENPN, CENPT and CENPU (PubMed:16622420, PubMed:16622419). The CENPA-NAC complex interacts with the CENPA-CAD complex, composed of CENPI, CENPK, CENPL, CENPO, CENPP, CENPQ, CENPR and CENPS. Interacts directly with CENPA (PubMed:19543270). Identified in a centromere complex containing histones H2A, H2B and H4, and at least CENPA, CENPB, CENPC, CENPT, CENPN, HJURP, SUPT16H, SSRP1 and RSF1 (PubMed:27499292).4 Publications

Protein-protein interaction databases

BioGridi120942, 28 interactors
CORUMiQ96H22
IntActiQ96H22, 10 interactors
STRINGi9606.ENSP00000377007

Structurei

Secondary structure

1339
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SMRiQ96H22
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the CENP-N/CHL4 family.Curated

Phylogenomic databases

eggNOGiENOG410IKJC Eukaryota
ENOG4111H2Z LUCA
GeneTreeiENSGT00390000004738
HOGENOMiHOG000015409
HOVERGENiHBG058868
InParanoidiQ96H22
KOiK11506
OMAiETFGDYP
OrthoDBiEOG091G0YMK
PhylomeDBiQ96H22
TreeFamiTF329714

Family and domain databases

InterProiView protein in InterPro
IPR007902 Chl4/mis15/CENP-N
PANTHERiPTHR12309:SF12 PTHR12309:SF12, 1 hit
PfamiView protein in Pfam
PF05238 CENP-N, 1 hit

Sequences (5+)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 3 potential isoforms that are computationally mapped.iShow all

Isoform 1 (identifier: Q96H22-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MDETVAEFIK RTILKIPMNE LTTILKAWDF LSENQLQTVN FRQRKESVVQ
60 70 80 90 100
HLIHLCEEKR ASISDAALLD IIYMQFHQHQ KVWEVFQMSK GPGEDVDLFD
110 120 130 140 150
MKQFKNSFKK ILQRALKNVT VSFRETEENA VWIRIAWGTQ YTKPNQYKPT
160 170 180 190 200
YVVYYSQTPY AFTSSSMLRR NTPLLGQALT IASKHHQIVK MDLRSRYLDS
210 220 230 240 250
LKAIVFKQYN QTFETHNSTT PLQERSLGLD INMDSRIIHE NIVEKERVQR
260 270 280 290 300
ITQETFGDYP QPQLEFAQYK LETKFKSGLN GSILAEREEP LRCLIKFSSP
310 320 330
HLLEALKSLA PAGIADAPLS PLLTCIPNKR MNYFKIRDK
Length:339
Mass (Da):39,555
Last modified:October 5, 2010 - v2
Checksum:i7A0D3326032DE99B
GO
Isoform 2 (identifier: Q96H22-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     178-204: ALTIASKHHQIVKMDLRSRYLDSLKAI → ELEATGKIYLRQEEIILDITEMKKACN
     205-339: Missing.

Show »
Length:204
Mass (Da):24,067
Checksum:i3954E4F78E020360
GO
Isoform 3 (identifier: Q96H22-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     313-339: GIADAPLSPLLTCIPNKRMNYFKIRDK → ALVCRIQKLLCYSGSHSQGTQDPSSWQKDLYLLFVPLYPRC

Note: No experimental confirmation available.
Show »
Length:353
Mass (Da):41,194
Checksum:iB3366A33C89CD296
GO
Isoform 4 (identifier: Q96H22-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     73-93: YMQFHQHQKVWEVFQMSKGPG → C

Note: No experimental confirmation available.
Show »
Length:319
Mass (Da):37,083
Checksum:i52873DA13A654ED2
GO
Isoform 5 (identifier: Q96H22-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     177-210: Missing.

Note: No experimental confirmation available.
Show »
Length:305
Mass (Da):35,556
Checksum:i5D7E6CFAB91045CD
GO

Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H3BMC7H3BMC7_HUMAN
Centromere protein N
CENPN
177Annotation score:
H3BMD5H3BMD5_HUMAN
Centromere protein N
CENPN
76Annotation score:
H3BRU7H3BRU7_HUMAN
Centromere protein N
CENPN
105Annotation score:

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti139T → A in AK026313 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_02741984E → D4 PublicationsCorresponds to variant dbSNP:rs935939Ensembl.1
Natural variantiVAR_048689223Q → R. Corresponds to variant dbSNP:rs11641523Ensembl.1
Natural variantiVAR_048690288E → K1 PublicationCorresponds to variant dbSNP:rs2549887Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_04468973 – 93YMQFH…SKGPG → C in isoform 4. 1 PublicationAdd BLAST21
Alternative sequenceiVSP_044690177 – 210Missing in isoform 5. 1 PublicationAdd BLAST34
Alternative sequenceiVSP_020441178 – 204ALTIA…SLKAI → ELEATGKIYLRQEEIILDIT EMKKACN in isoform 2. 2 PublicationsAdd BLAST27
Alternative sequenceiVSP_020442205 – 339Missing in isoform 2. 2 PublicationsAdd BLAST135
Alternative sequenceiVSP_044565313 – 339GIADA…KIRDK → ALVCRIQKLLCYSGSHSQGT QDPSSWQKDLYLLFVPLYPR C in isoform 3. 1 PublicationAdd BLAST27

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF217515 mRNA Translation: AAF67626.1
AK023669 mRNA Translation: BAG51215.1
AK026313 mRNA No translation available.
AK298554 mRNA Translation: BAG60749.1
AK296024 mRNA Translation: BAG58793.1
AC092718 Genomic DNA No translation available.
CH471114 Genomic DNA Translation: EAW95553.1
CH471114 Genomic DNA Translation: EAW95556.1
BC007334 mRNA Translation: AAH07334.1
BC008972 mRNA Translation: AAH08972.1
CCDSiCCDS10931.1 [Q96H22-2]
CCDS42199.1 [Q96H22-3]
CCDS42200.1 [Q96H22-1]
CCDS58482.1 [Q96H22-5]
CCDS58483.1 [Q96H22-4]
RefSeqiNP_001094094.2, NM_001100624.2 [Q96H22-1]
NP_001094095.2, NM_001100625.2 [Q96H22-3]
NP_001257402.1, NM_001270473.1 [Q96H22-4]
NP_001257403.1, NM_001270474.1 [Q96H22-5]
NP_060925.2, NM_018455.5 [Q96H22-2]
XP_006721299.1, XM_006721236.3 [Q96H22-1]
XP_016878945.1, XM_017023456.1 [Q96H22-2]
UniGeneiHs.726537

Genome annotation databases

EnsembliENST00000299572; ENSP00000299572; ENSG00000166451 [Q96H22-2]
ENST00000305850; ENSP00000305608; ENSG00000166451 [Q96H22-1]
ENST00000393335; ENSP00000377007; ENSG00000166451 [Q96H22-3]
ENST00000428963; ENSP00000393991; ENSG00000166451 [Q96H22-5]
ENST00000439957; ENSP00000395235; ENSG00000166451 [Q96H22-4]
GeneIDi55839
KEGGihsa:55839
UCSCiuc002ffw.5 human [Q96H22-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiCENPN_HUMAN
AccessioniPrimary (citable) accession number: Q96H22
Secondary accession number(s): A8MZE6
, B3KN53, B4DJD1, B4DPY7, C9JJM5, D3DUK8, E7ES30, E7ETS3, Q9NZ83
Entry historyiIntegrated into UniProtKB/Swiss-Prot: September 19, 2006
Last sequence update: October 5, 2010
Last modified: September 12, 2018
This is version 135 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again