Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Solute carrier family 41 member 3

Gene

SLC41A3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

GO - Molecular functioni

Protein family/group databases

TCDBi1.A.26.2.3 the mg(2+) transporter-e (mgte) family

Names & Taxonomyi

Protein namesi
Recommended name:
Solute carrier family 41 member 3
Gene namesi
Name:SLC41A3
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 3

Organism-specific databases

EuPathDBiHostDB:ENSG00000114544.15
HGNCiHGNC:31046 SLC41A3
MIMi610803 gene
neXtProtiNX_Q96GZ6

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Transmembranei67 – 87HelicalSequence analysisAdd BLAST21
Transmembranei152 – 172HelicalSequence analysisAdd BLAST21
Transmembranei189 – 209HelicalSequence analysisAdd BLAST21
Transmembranei220 – 240HelicalSequence analysisAdd BLAST21
Transmembranei252 – 272HelicalSequence analysisAdd BLAST21
Transmembranei284 – 304HelicalSequence analysisAdd BLAST21
Transmembranei314 – 334HelicalSequence analysisAdd BLAST21
Transmembranei377 – 397HelicalSequence analysisAdd BLAST21
Transmembranei406 – 426HelicalSequence analysisAdd BLAST21
Transmembranei482 – 502HelicalSequence analysisAdd BLAST21

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000114544
PharmGKBiPA134878151

Polymorphism and mutation databases

BioMutaiSLC41A3
DMDMi313104184

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002955921 – 507Solute carrier family 41 member 3Add BLAST507

Proteomic databases

MaxQBiQ96GZ6
PaxDbiQ96GZ6
PeptideAtlasiQ96GZ6
PRIDEiQ96GZ6
ProteomicsDBi76685
76686 [Q96GZ6-2]
76687 [Q96GZ6-3]
76688 [Q96GZ6-4]
76689 [Q96GZ6-5]
76690 [Q96GZ6-6]
76691 [Q96GZ6-7]
76692 [Q96GZ6-8]
TopDownProteomicsiQ96GZ6-7 [Q96GZ6-7]

PTM databases

iPTMnetiQ96GZ6
PhosphoSitePlusiQ96GZ6
SwissPalmiQ96GZ6

Expressioni

Gene expression databases

BgeeiENSG00000114544 Expressed in 213 organ(s), highest expression level in cerebellar hemisphere
CleanExiHS_SLC41A3
ExpressionAtlasiQ96GZ6 baseline and differential
GenevisibleiQ96GZ6 HS

Organism-specific databases

HPAiHPA045847

Interactioni

Binary interactionsi

Protein-protein interaction databases

BioGridi120285, 13 interactors
IntActiQ96GZ6, 13 interactors
MINTiQ96GZ6
STRINGi9606.ENSP00000326070

Structurei

3D structure databases

ProteinModelPortaliQ96GZ6
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi378 – 381Poly-Leu4

Sequence similaritiesi

Belongs to the SLC41A transporter family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG3788 Eukaryota
ENOG410XSTG LUCA
GeneTreeiENSGT00390000016816
HOGENOMiHOG000007017
HOVERGENiHBG057187
InParanoidiQ96GZ6
KOiK15122
OMAiTQLNLEF
OrthoDBiEOG091G08MB
PhylomeDBiQ96GZ6
TreeFamiTF313647

Family and domain databases

InterProiView protein in InterPro
IPR006667 SLC41_membr_dom
IPR036739 SLC41_membr_dom_sf
PfamiView protein in Pfam
PF01769 MgtE, 2 hits
SUPFAMiSSF161093 SSF161093, 2 hits

Sequences (9+)i

Sequence statusi: Complete.

This entry describes 9 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 9 described isoforms and 10 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q96GZ6-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MDGTETRQRR LDSCGKPGEL GLPHPLSTGG LPVASEDGAL RAPESQSVTP
60 70 80 90 100
KPLETEPSRE TTWSIGLQVT VPFMFAGLGL SWAGMLLDYF QHWPVFVEVK
110 120 130 140 150
DLLTLVPPLV GLKGNLEMTL ASRLSTAANT GQIDDPQEQH RVISSNLALI
160 170 180 190 200
QVQATVVGLL AAVAALLLGV VSREEVDVAK VELLCASSVL TAFLAAFALG
210 220 230 240 250
VLMVCIVIGA RKLGVNPDNI ATPIAASLGD LITLSILALV SSFFYRHKDS
260 270 280 290 300
RYLTPLVCLS FAALTPVWVL IAKQSPPIVK ILKFGWFPII LAMVISSFGG
310 320 330 340 350
LILSKTVSKQ QYKGMAIFTP VICGVGGNLV AIQTSRISTY LHMWSAPGVL
360 370 380 390 400
PLQMKKFWPN PCSTFCTSEI NSMSARVLLL LVVPGHLIFF YIIYLVEGQS
410 420 430 440 450
VINSQTFVVL YLLAGLIQVT ILLYLAEVMV RLTWHQALDP DNHCIPYLTG
460 470 480 490 500
LGDLLGSSSV GHTAAVPRRC TASPGWGLIQ PFICTQHLIV SLLSFYFPFC

LLAKTSI
Length:507
Mass (Da):54,767
Last modified:November 30, 2010 - v2
Checksum:iEA2C1C9216F01AA1
GO
Isoform 2 (identifier: Q96GZ6-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     501-507: Missing.

Show »
Length:500
Mass (Da):54,040
Checksum:i01EE7EF739103D9A
GO
Isoform 3 (identifier: Q96GZ6-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     92-127: Missing.

Show »
Length:471
Mass (Da):50,839
Checksum:i077454E8023458E1
GO
Isoform 4 (identifier: Q96GZ6-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     92-127: Missing.
     501-507: Missing.

Show »
Length:464
Mass (Da):50,112
Checksum:i014C542234BD1E66
GO
Isoform 5 (identifier: Q96GZ6-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     61-69: Missing.
     457-507: SSSVGHTAAV...PFCLLAKTSI → TGLLALCFFTDWLLKSKAELGGISELASGPP

Show »
Length:478
Mass (Da):51,493
Checksum:i073256C0E3E0035D
GO
Isoform 6 (identifier: Q96GZ6-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     218-266: Missing.
     457-507: SSSVGHTAAV...PFCLLAKTSI → TGLLALCFFTDWLLKSKAELGGISELASGPP

Show »
Length:438
Mass (Da):47,200
Checksum:iB5C3D56EE1863859
GO
Isoform 7 (identifier: Q96GZ6-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-26: Missing.
     27-90: STGGLPVASE...SWAGMLLDYF → MVVTQLNLEF...MTAGLVMNTI
     457-507: SSSVGHTAAV...PFCLLAKTSI → TGLLALCFFTDWLLKSKAELGGISELASGPP

Show »
Length:461
Mass (Da):49,916
Checksum:iDB62D800839C29A0
GO
Isoform 8 (identifier: Q96GZ6-8) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-117: Missing.
     457-507: SSSVGHTAAV...PFCLLAKTSI → TGLLALCFFTDWLLKSKAELGGISELASGPP

Note: No experimental confirmation available.
Show »
Length:370
Mass (Da):39,828
Checksum:i8FC413D1A828CB95
GO
Isoform 9 (identifier: Q96GZ6-9) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     457-487: SSSVGHTAAVPRRCTASPGWGLIQPFICTQH → TGLLALCFFTDWLLKSKAELGGISELASGPP
     488-507: Missing.

Note: No experimental confirmation available.
Show »
Length:487
Mass (Da):52,479
Checksum:i33C81692DC272150
GO

Computationally mapped potential isoform sequencesi

There are 10 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
D6RHE3D6RHE3_HUMAN
Solute carrier family 41 member 3
SLC41A3
201Annotation score:
D6RDB0D6RDB0_HUMAN
Solute carrier family 41 member 3
SLC41A3
288Annotation score:
D6R9X6D6R9X6_HUMAN
Solute carrier family 41 member 3
SLC41A3
294Annotation score:
D6R9M9D6R9M9_HUMAN
Solute carrier family 41 member 3
SLC41A3
174Annotation score:
D6RC02D6RC02_HUMAN
Solute carrier family 41 member 3
SLC41A3
137Annotation score:
D6RF72D6RF72_HUMAN
Solute carrier family 41 member 3
SLC41A3
138Annotation score:
D6RDM3D6RDM3_HUMAN
Solute carrier family 41 member 3
SLC41A3
65Annotation score:
D6R9S7D6R9S7_HUMAN
Solute carrier family 41 member 3
SLC41A3
152Annotation score:
D6RJC0D6RJC0_HUMAN
Solute carrier family 41 member 3
SLC41A3
92Annotation score:
D6R925D6R925_HUMAN
Solute carrier family 41 member 3
SLC41A3
85Annotation score:

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti331A → G in BAC03717 (PubMed:14702039).Curated1
Sequence conflicti387L → P in BAB13938 (PubMed:14702039).Curated1
Sequence conflicti405Q → R in BAC03717 (PubMed:14702039).Curated1
Sequence conflicti448L → P in BAB13938 (PubMed:14702039).Curated1
Isoform 7 (identifier: Q96GZ6-7)
Sequence conflicti432G → S in BAG52701 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_03329662T → A2 PublicationsCorresponds to variant dbSNP:rs4234270Ensembl.1
Natural variantiVAR_04666771V → M1 PublicationCorresponds to variant dbSNP:rs11543283Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0436761 – 117Missing in isoform 8. 1 PublicationAdd BLAST117
Alternative sequenceiVSP_0355051 – 26Missing in isoform 7. 1 PublicationAdd BLAST26
Alternative sequenceiVSP_03550627 – 90STGGL…LLDYF → MVVTQLNLEFCFQGKKLRGF SCELTRSPHGVLPESFFTIM CQVVVPILLSGLCMMTAGLV MNTI in isoform 7. 1 PublicationAdd BLAST64
Alternative sequenceiVSP_02693461 – 69Missing in isoform 5. 1 Publication9
Alternative sequenceiVSP_02693592 – 127Missing in isoform 3 and isoform 4. 1 PublicationAdd BLAST36
Alternative sequenceiVSP_026936218 – 266Missing in isoform 6. 1 PublicationAdd BLAST49
Alternative sequenceiVSP_026937457 – 507SSSVG…AKTSI → TGLLALCFFTDWLLKSKAEL GGISELASGPP in isoform 5, isoform 6, isoform 7 and isoform 8. 1 PublicationAdd BLAST51
Alternative sequenceiVSP_054059457 – 487SSSVG…ICTQH → TGLLALCFFTDWLLKSKAEL GGISELASGPP in isoform 9. 1 PublicationAdd BLAST31
Alternative sequenceiVSP_054060488 – 507Missing in isoform 9. 1 PublicationAdd BLAST20
Alternative sequenceiVSP_026938501 – 507Missing in isoform 2 and isoform 4. 2 Publications7

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK000480 mRNA Translation: BAA91192.1
AK021925 mRNA Translation: BAB13938.1
AK022780 mRNA Translation: BAB14241.1
AK091671 mRNA Translation: BAC03717.1
AK093380 mRNA Translation: BAG52701.1
AK298070 mRNA Translation: BAH12718.1
AC079848 Genomic DNA No translation available.
AC092903 Genomic DNA No translation available.
AC117422 Genomic DNA No translation available.
BC009444 mRNA No translation available.
BC009039 mRNA Translation: AAH09039.1
BC028241 mRNA Translation: AAH28241.1
CCDSiCCDS33842.1 [Q96GZ6-3]
CCDS33843.1 [Q96GZ6-1]
CCDS33844.1 [Q96GZ6-7]
CCDS43144.1 [Q96GZ6-9]
CCDS54635.1 [Q96GZ6-8]
RefSeqiNP_001008485.1, NM_001008485.1
NP_001008486.1, NM_001008486.1
NP_001008487.1, NM_001008487.1 [Q96GZ6-7]
NP_001157947.1, NM_001164475.1 [Q96GZ6-8]
XP_005247619.1, XM_005247562.1 [Q96GZ6-1]
XP_005247620.1, XM_005247563.2 [Q96GZ6-1]
XP_006713744.1, XM_006713681.2 [Q96GZ6-1]
XP_016862195.1, XM_017006706.1 [Q96GZ6-9]
XP_016862196.1, XM_017006707.1 [Q96GZ6-9]
UniGeneiHs.573007

Genome annotation databases

EnsembliENST00000315891; ENSP00000326070; ENSG00000114544 [Q96GZ6-1]
ENST00000346785; ENSP00000264471; ENSG00000114544 [Q96GZ6-3]
ENST00000360370; ENSP00000353533; ENSG00000114544 [Q96GZ6-9]
ENST00000383598; ENSP00000373092; ENSG00000114544 [Q96GZ6-7]
ENST00000508835; ENSP00000427409; ENSG00000114544 [Q96GZ6-8]
GeneIDi54946
KEGGihsa:54946
UCSCiuc003eii.4 human [Q96GZ6-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK000480 mRNA Translation: BAA91192.1
AK021925 mRNA Translation: BAB13938.1
AK022780 mRNA Translation: BAB14241.1
AK091671 mRNA Translation: BAC03717.1
AK093380 mRNA Translation: BAG52701.1
AK298070 mRNA Translation: BAH12718.1
AC079848 Genomic DNA No translation available.
AC092903 Genomic DNA No translation available.
AC117422 Genomic DNA No translation available.
BC009444 mRNA No translation available.
BC009039 mRNA Translation: AAH09039.1
BC028241 mRNA Translation: AAH28241.1
CCDSiCCDS33842.1 [Q96GZ6-3]
CCDS33843.1 [Q96GZ6-1]
CCDS33844.1 [Q96GZ6-7]
CCDS43144.1 [Q96GZ6-9]
CCDS54635.1 [Q96GZ6-8]
RefSeqiNP_001008485.1, NM_001008485.1
NP_001008486.1, NM_001008486.1
NP_001008487.1, NM_001008487.1 [Q96GZ6-7]
NP_001157947.1, NM_001164475.1 [Q96GZ6-8]
XP_005247619.1, XM_005247562.1 [Q96GZ6-1]
XP_005247620.1, XM_005247563.2 [Q96GZ6-1]
XP_006713744.1, XM_006713681.2 [Q96GZ6-1]
XP_016862195.1, XM_017006706.1 [Q96GZ6-9]
XP_016862196.1, XM_017006707.1 [Q96GZ6-9]
UniGeneiHs.573007

3D structure databases

ProteinModelPortaliQ96GZ6
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi120285, 13 interactors
IntActiQ96GZ6, 13 interactors
MINTiQ96GZ6
STRINGi9606.ENSP00000326070

Protein family/group databases

TCDBi1.A.26.2.3 the mg(2+) transporter-e (mgte) family

PTM databases

iPTMnetiQ96GZ6
PhosphoSitePlusiQ96GZ6
SwissPalmiQ96GZ6

Polymorphism and mutation databases

BioMutaiSLC41A3
DMDMi313104184

Proteomic databases

MaxQBiQ96GZ6
PaxDbiQ96GZ6
PeptideAtlasiQ96GZ6
PRIDEiQ96GZ6
ProteomicsDBi76685
76686 [Q96GZ6-2]
76687 [Q96GZ6-3]
76688 [Q96GZ6-4]
76689 [Q96GZ6-5]
76690 [Q96GZ6-6]
76691 [Q96GZ6-7]
76692 [Q96GZ6-8]
TopDownProteomicsiQ96GZ6-7 [Q96GZ6-7]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000315891; ENSP00000326070; ENSG00000114544 [Q96GZ6-1]
ENST00000346785; ENSP00000264471; ENSG00000114544 [Q96GZ6-3]
ENST00000360370; ENSP00000353533; ENSG00000114544 [Q96GZ6-9]
ENST00000383598; ENSP00000373092; ENSG00000114544 [Q96GZ6-7]
ENST00000508835; ENSP00000427409; ENSG00000114544 [Q96GZ6-8]
GeneIDi54946
KEGGihsa:54946
UCSCiuc003eii.4 human [Q96GZ6-1]

Organism-specific databases

CTDi54946
EuPathDBiHostDB:ENSG00000114544.15
GeneCardsiSLC41A3
HGNCiHGNC:31046 SLC41A3
HPAiHPA045847
MIMi610803 gene
neXtProtiNX_Q96GZ6
OpenTargetsiENSG00000114544
PharmGKBiPA134878151
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG3788 Eukaryota
ENOG410XSTG LUCA
GeneTreeiENSGT00390000016816
HOGENOMiHOG000007017
HOVERGENiHBG057187
InParanoidiQ96GZ6
KOiK15122
OMAiTQLNLEF
OrthoDBiEOG091G08MB
PhylomeDBiQ96GZ6
TreeFamiTF313647

Miscellaneous databases

ChiTaRSiSLC41A3 human
GeneWikiiSLC41A3
GenomeRNAii54946
PROiPR:Q96GZ6
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000114544 Expressed in 213 organ(s), highest expression level in cerebellar hemisphere
CleanExiHS_SLC41A3
ExpressionAtlasiQ96GZ6 baseline and differential
GenevisibleiQ96GZ6 HS

Family and domain databases

InterProiView protein in InterPro
IPR006667 SLC41_membr_dom
IPR036739 SLC41_membr_dom_sf
PfamiView protein in Pfam
PF01769 MgtE, 2 hits
SUPFAMiSSF161093 SSF161093, 2 hits
ProtoNetiSearch...

Entry informationi

Entry nameiS41A3_HUMAN
AccessioniPrimary (citable) accession number: Q96GZ6
Secondary accession number(s): A6ND60
, B3KSD9, B7Z4Y2, C9JE96, E7ENY4, Q8N342, Q8NB27, Q9H9I6, Q9HAB1, Q9NX30
Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 24, 2007
Last sequence update: November 30, 2010
Last modified: November 7, 2018
This is version 131 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again