Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 147 (18 Sep 2019)
Sequence version 1 (01 Dec 2001)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Alpha/beta hydrolase domain-containing protein 17A

Gene

ABHD17A

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Hydrolyzes fatty acids from S-acylated cysteine residues in proteins (PubMed:26701913). Has depalmitoylating activity towards NRAS (PubMed:26701913). Has depalmitoylating activity towards DLG4/PSD95 (PubMed:26701913). May have depalmitoylating activity towards MAP6 (By similarity).By similarity1 Publication

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes regulatory mechanisms for enzymes, transporters or microbial transcription factors, and reports the components which regulate (by activation or inhibition) the reaction.<p><a href='/help/activity_regulation' target='_top'>More...</a></p>Activity regulationi

Inhibited by palmostatin-B.1 Publication

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei190Charge relay system1 Publication1
Active sitei255Charge relay systemBy similarity1
Active sitei284Charge relay systemBy similarity1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • palmitoyl-(protein) hydrolase activity Source: UniProtKB

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionHydrolase

Protein family/group databases

ESTHER database of the Alpha/Beta-hydrolase fold superfamily of proteins

More...
ESTHERi
human-ABHD17A ABHD17-depalmitoylase

MEROPS protease database

More...
MEROPSi
S09.052

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Alpha/beta hydrolase domain-containing protein 17ACurated (EC:3.1.2.221 Publication)
Short name:
Abhydrolase domain-containing protein 17AImported
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:ABHD17AImported
Synonyms:C19orf27, FAM108A1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 19

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:28756 ABHD17A

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
617942 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q96GS6

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell junction, Cell membrane, Cell projection, Endosome, Membrane, Postsynaptic cell membrane, Synapse

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi1 – 19Missing : Reduces catalytic activity. Loss of membrane localization. No effect on NRAS plasma membrane localization. 1 PublicationAdd BLAST19
Mutagenesisi190S → A: Loss of catalytic activity. No effect on its localization. No effect on NRAS plasma membrane localization. 1 Publication1

Organism-specific databases

Open Targets

More...
OpenTargetsi
ENSG00000129968

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA134947443

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
ABHD17A

Domain mapping of disease mutations (DMDM)

More...
DMDMi
74751891

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002975091 – 310Alpha/beta hydrolase domain-containing protein 17AAdd BLAST310

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei307PhosphoserineCombined sources1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Palmitoylated on cysteine residues located in a cysteine cluster at the N-terminus which promotes membrane localization (PubMed:26701913). Palmitoylation is required for post-synaptic localization and for depalmitoylating activity towards DLG4/PSD95 (By similarity).By similarity1 Publication

Keywords - PTMi

Lipoprotein, Palmitate, Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q96GS6

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q96GS6

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q96GS6

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q96GS6

PeptideAtlas

More...
PeptideAtlasi
Q96GS6

PRoteomics IDEntifications database

More...
PRIDEi
Q96GS6

ProteomicsDB human proteome resource

More...
ProteomicsDBi
76661 [Q96GS6-1]
76662 [Q96GS6-2]
76663 [Q96GS6-3]
76664 [Q96GS6-4]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q96GS6

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q96GS6

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
Q96GS6

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000129968 Expressed in 92 organ(s), highest expression level in prefrontal cortex

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q96GS6 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q96GS6 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA043270
HPA047226

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
123627, 21 interactors

Protein interaction database and analysis system

More...
IntActi
Q96GS6, 19 interactors

Molecular INTeraction database

More...
MINTi
Q96GS6

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the AB hydrolase superfamily. ABHD17 family.Curated

Phylogenomic databases

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000155854

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q96GS6

KEGG Orthology (KO)

More...
KOi
K01076

Identification of Orthologs from Complete Genome Data

More...
OMAi
TWCCDAF

Database of Orthologous Groups

More...
OrthoDBi
691954at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q96GS6

TreeFam database of animal gene trees

More...
TreeFami
TF314365

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
3.40.50.1820, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR029058 AB_hydrolase
IPR022742 Hydrolase_4

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF12146 Hydrolase_4, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF53474 SSF53474, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q96GS6-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MNGLSLSELC CLFCCPPCPG RIAAKLAFLP PEATYSLVPE PEPGPGGAGA
60 70 80 90 100
APLGTLRASS GAPGRWKLHL TERADFQYSQ RELDTIEVFP TKSARGNRVS
110 120 130 140 150
CMYVRCVPGA RYTVLFSHGN AVDLGQMSSF YIGLGSRLHC NIFSYDYSGY
160 170 180 190 200
GASSGRPSER NLYADIDAAW QALRTRYGIS PDSIILYGQS IGTVPTVDLA
210 220 230 240 250
SRYECAAVVL HSPLTSGMRV AFPDTKKTYC FDAFPNIEKV SKITSPVLII
260 270 280 290 300
HGTEDEVIDF SHGLALYERC PKAVEPLWVE GAGHNDIELY SQYLERLRRF
310
ISQELPSQRA
Length:310
Mass (Da):33,990
Last modified:December 1, 2001 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i35FC521C6C245BA0
GO
Isoform 2 (identifier: Q96GS6-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     109-109: G → GARQGHQAQGGHPQLAWVGRLGDSNNPAPGGCLLGKSWGTGAALACGYIHLL

Show »
Length:361
Mass (Da):39,136
Checksum:i0C7BD4C0C50C8792
GO
Isoform 3 (identifier: Q96GS6-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     236-236: N → K
     237-310: Missing.

Show »
Length:236
Mass (Da):25,529
Checksum:iBB7B6CD4879BD95F
GO
Isoform 4 (identifier: Q96GS6-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     177-310: Missing.

Show »
Length:176
Mass (Da):19,048
Checksum:i2E606EF6126C01C7
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
K7EQ25K7EQ25_HUMAN
Alpha/beta hydrolase domain-contain...
ABHD17A
225Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
K7ENJ6K7ENJ6_HUMAN
Alpha/beta hydrolase domain-contain...
ABHD17A
39Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAB15709 differs from that shown. Reason: Erroneous initiation.Curated
The sequence BAB84869 differs from that shown. Reason: Erroneous initiation.Curated
The sequence BAC03419 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti98R → H in AAH00158 (PubMed:15489334).Curated1
Sequence conflicti98R → H in AAH11667 (PubMed:15489334).Curated1
Isoform 2 (identifier: Q96GS6-2)
Sequence conflicti144K → E in AAH20512 (PubMed:15489334).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_027268109G → GARQGHQAQGGHPQLAWVGR LGDSNNPAPGGCLLGKSWGT GAALACGYIHLL in isoform 2. 1 Publication1
Alternative sequenceiVSP_027271177 – 310Missing in isoform 4. 1 PublicationAdd BLAST134
Alternative sequenceiVSP_027269236N → K in isoform 3. 1 Publication1
Alternative sequenceiVSP_027270237 – 310Missing in isoform 3. 1 PublicationAdd BLAST74

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AK024419 mRNA Translation: BAB15709.1 Different initiation.
AK074043 mRNA Translation: BAB84869.1 Different initiation.
AK289533 mRNA Translation: BAF82222.1
AK090438 mRNA Translation: BAC03419.1 Different initiation.
AK074548 mRNA Translation: BAC11052.1
CH471139 Genomic DNA Translation: EAW69441.1
CH471139 Genomic DNA Translation: EAW69444.1
CH471139 Genomic DNA Translation: EAW69446.1
BC000158 mRNA Translation: AAH00158.1
BC009256 mRNA Translation: AAH09256.1
BC011667 mRNA Translation: AAH11667.1
BC020512 mRNA Translation: AAH20512.1
BC033749 mRNA Translation: AAH33749.1
BC035961 mRNA Translation: AAH35961.1
BC071644 mRNA Translation: AAH71644.1
BC071876 mRNA Translation: AAH71876.1
BC094816 mRNA Translation: AAH94816.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS32867.1 [Q96GS6-2]
CCDS45902.1 [Q96GS6-1]

NCBI Reference Sequences

More...
RefSeqi
NP_001123583.1, NM_001130111.1 [Q96GS6-1]
NP_112490.3, NM_031213.3 [Q96GS6-2]
XP_011526640.1, XM_011528338.1 [Q96GS6-2]
XP_016882830.1, XM_017027341.1

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000250974; ENSP00000250974; ENSG00000129968 [Q96GS6-2]
ENST00000292577; ENSP00000292577; ENSG00000129968 [Q96GS6-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
81926

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:81926

UCSC genome browser

More...
UCSCi
uc002luf.4 human [Q96GS6-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK024419 mRNA Translation: BAB15709.1 Different initiation.
AK074043 mRNA Translation: BAB84869.1 Different initiation.
AK289533 mRNA Translation: BAF82222.1
AK090438 mRNA Translation: BAC03419.1 Different initiation.
AK074548 mRNA Translation: BAC11052.1
CH471139 Genomic DNA Translation: EAW69441.1
CH471139 Genomic DNA Translation: EAW69444.1
CH471139 Genomic DNA Translation: EAW69446.1
BC000158 mRNA Translation: AAH00158.1
BC009256 mRNA Translation: AAH09256.1
BC011667 mRNA Translation: AAH11667.1
BC020512 mRNA Translation: AAH20512.1
BC033749 mRNA Translation: AAH33749.1
BC035961 mRNA Translation: AAH35961.1
BC071644 mRNA Translation: AAH71644.1
BC071876 mRNA Translation: AAH71876.1
BC094816 mRNA Translation: AAH94816.1
CCDSiCCDS32867.1 [Q96GS6-2]
CCDS45902.1 [Q96GS6-1]
RefSeqiNP_001123583.1, NM_001130111.1 [Q96GS6-1]
NP_112490.3, NM_031213.3 [Q96GS6-2]
XP_011526640.1, XM_011528338.1 [Q96GS6-2]
XP_016882830.1, XM_017027341.1

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

BioGridi123627, 21 interactors
IntActiQ96GS6, 19 interactors
MINTiQ96GS6

Protein family/group databases

ESTHERihuman-ABHD17A ABHD17-depalmitoylase
MEROPSiS09.052

PTM databases

iPTMnetiQ96GS6
PhosphoSitePlusiQ96GS6
SwissPalmiQ96GS6

Polymorphism and mutation databases

BioMutaiABHD17A
DMDMi74751891

Proteomic databases

EPDiQ96GS6
jPOSTiQ96GS6
MassIVEiQ96GS6
MaxQBiQ96GS6
PeptideAtlasiQ96GS6
PRIDEiQ96GS6
ProteomicsDBi76661 [Q96GS6-1]
76662 [Q96GS6-2]
76663 [Q96GS6-3]
76664 [Q96GS6-4]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000250974; ENSP00000250974; ENSG00000129968 [Q96GS6-2]
ENST00000292577; ENSP00000292577; ENSG00000129968 [Q96GS6-1]
GeneIDi81926
KEGGihsa:81926
UCSCiuc002luf.4 human [Q96GS6-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
81926

GeneCards: human genes, protein and diseases

More...
GeneCardsi
ABHD17A
HGNCiHGNC:28756 ABHD17A
HPAiHPA043270
HPA047226
MIMi617942 gene
neXtProtiNX_Q96GS6
OpenTargetsiENSG00000129968
PharmGKBiPA134947443

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

GeneTreeiENSGT00940000155854
InParanoidiQ96GS6
KOiK01076
OMAiTWCCDAF
OrthoDBi691954at2759
PhylomeDBiQ96GS6
TreeFamiTF314365

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
ABHD17A human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
81926

Pharos

More...
Pharosi
Q96GS6

Protein Ontology

More...
PROi
PR:Q96GS6

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000129968 Expressed in 92 organ(s), highest expression level in prefrontal cortex
ExpressionAtlasiQ96GS6 baseline and differential
GenevisibleiQ96GS6 HS

Family and domain databases

Gene3Di3.40.50.1820, 1 hit
InterProiView protein in InterPro
IPR029058 AB_hydrolase
IPR022742 Hydrolase_4
PfamiView protein in Pfam
PF12146 Hydrolase_4, 1 hit
SUPFAMiSSF53474 SSF53474, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiAB17A_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q96GS6
Secondary accession number(s): A8K0G8
, D6W5Z9, Q6PJU2, Q8WUH9, Q9BWL0, Q9H7Q9
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 24, 2007
Last sequence update: December 1, 2001
Last modified: September 18, 2019
This is version 147 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 19
    Human chromosome 19: entries, gene names and cross-references to MIM
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again