Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Alpha/beta hydrolase domain-containing protein 17A

Gene

ABHD17A

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Hydrolyzes fatty acids from S-acylated cysteine residues in proteins (PubMed:26701913). Has depalmitoylating activity towards NRAS (PubMed:26701913). Has depalmitoylating activity towards DLG4/PSD95 (PubMed:26701913). May have depalmitoylating activity towards MAP6 (By similarity).By similarity1 Publication

Catalytic activityi

Palmitoyl-[protein] + H2O = palmitate + [protein].1 Publication

Activity regulationi

Inhibited by palmostatin-B.1 Publication

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Active sitei190Charge relay system1 Publication1
Active sitei255Charge relay systemBy similarity1
Active sitei284Charge relay systemBy similarity1

GO - Molecular functioni

  • palmitoyl-(protein) hydrolase activity Source: UniProtKB

GO - Biological processi

Keywordsi

Molecular functionHydrolase

Protein family/group databases

ESTHERihuman-ABHD17A ABHD17-depalmitoylase
MEROPSiS09.052

Names & Taxonomyi

Protein namesi
Recommended name:
Alpha/beta hydrolase domain-containing protein 17ACurated (EC:3.1.2.221 Publication)
Short name:
Abhydrolase domain-containing protein 17AImported
Gene namesi
Name:ABHD17AImported
Synonyms:C19orf27, FAM108A1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 19

Organism-specific databases

EuPathDBiHostDB:ENSG00000129968.15
HGNCiHGNC:28756 ABHD17A
MIMi617942 gene
neXtProtiNX_Q96GS6

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell junction, Cell membrane, Cell projection, Endosome, Membrane, Postsynaptic cell membrane, Synapse

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi1 – 19Missing : Reduces catalytic activity. Loss of membrane localization. No effect on NRAS plasma membrane localization. 1 PublicationAdd BLAST19
Mutagenesisi190S → A: Loss of catalytic activity. No effect on its localization. No effect on NRAS plasma membrane localization. 1 Publication1

Organism-specific databases

OpenTargetsiENSG00000129968
PharmGKBiPA134947443

Polymorphism and mutation databases

BioMutaiABHD17A
DMDMi74751891

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002975091 – 310Alpha/beta hydrolase domain-containing protein 17AAdd BLAST310

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei307PhosphoserineCombined sources1

Post-translational modificationi

Palmitoylated on cysteine residues located in a cysteine cluster at the N-terminus which promotes membrane localization (PubMed:26701913). Palmitoylation is required for post-synaptic localization and for depalmitoylating activity towards DLG4/PSD95 (By similarity).By similarity1 Publication

Keywords - PTMi

Lipoprotein, Palmitate, Phosphoprotein

Proteomic databases

EPDiQ96GS6
MaxQBiQ96GS6
PeptideAtlasiQ96GS6
PRIDEiQ96GS6
ProteomicsDBi76661
76662 [Q96GS6-2]
76663 [Q96GS6-3]
76664 [Q96GS6-4]

PTM databases

iPTMnetiQ96GS6
PhosphoSitePlusiQ96GS6
SwissPalmiQ96GS6

Expressioni

Gene expression databases

BgeeiENSG00000129968 Expressed in 92 organ(s), highest expression level in prefrontal cortex
CleanExiHS_FAM108A1
ExpressionAtlasiQ96GS6 baseline and differential
GenevisibleiQ96GS6 HS

Organism-specific databases

HPAiHPA043270
HPA047226

Interactioni

Binary interactionsi

Protein-protein interaction databases

BioGridi123627, 21 interactors
IntActiQ96GS6, 14 interactors
MINTiQ96GS6

Structurei

3D structure databases

ProteinModelPortaliQ96GS6
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the AB hydrolase superfamily. ABHD17 family.Curated

Phylogenomic databases

GeneTreeiENSGT00390000000948
HOVERGENiHBG061270
InParanoidiQ96GS6
KOiK01076
OMAiTWCCDAF
OrthoDBiEOG091G0EV3
PhylomeDBiQ96GS6
TreeFamiTF314365

Family and domain databases

Gene3Di3.40.50.1820, 1 hit
InterProiView protein in InterPro
IPR029058 AB_hydrolase
IPR022742 Hydrolase_4
PfamiView protein in Pfam
PF12146 Hydrolase_4, 1 hit
SUPFAMiSSF53474 SSF53474, 1 hit

Sequences (4+)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q96GS6-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MNGLSLSELC CLFCCPPCPG RIAAKLAFLP PEATYSLVPE PEPGPGGAGA
60 70 80 90 100
APLGTLRASS GAPGRWKLHL TERADFQYSQ RELDTIEVFP TKSARGNRVS
110 120 130 140 150
CMYVRCVPGA RYTVLFSHGN AVDLGQMSSF YIGLGSRLHC NIFSYDYSGY
160 170 180 190 200
GASSGRPSER NLYADIDAAW QALRTRYGIS PDSIILYGQS IGTVPTVDLA
210 220 230 240 250
SRYECAAVVL HSPLTSGMRV AFPDTKKTYC FDAFPNIEKV SKITSPVLII
260 270 280 290 300
HGTEDEVIDF SHGLALYERC PKAVEPLWVE GAGHNDIELY SQYLERLRRF
310
ISQELPSQRA
Length:310
Mass (Da):33,990
Last modified:December 1, 2001 - v1
Checksum:i35FC521C6C245BA0
GO
Isoform 2 (identifier: Q96GS6-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     109-109: G → GARQGHQAQGGHPQLAWVGRLGDSNNPAPGGCLLGKSWGTGAALACGYIHLL

Show »
Length:361
Mass (Da):39,136
Checksum:i0C7BD4C0C50C8792
GO
Isoform 3 (identifier: Q96GS6-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     236-236: N → K
     237-310: Missing.

Show »
Length:236
Mass (Da):25,529
Checksum:iBB7B6CD4879BD95F
GO
Isoform 4 (identifier: Q96GS6-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     177-310: Missing.

Show »
Length:176
Mass (Da):19,048
Checksum:i2E606EF6126C01C7
GO

Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
K7EQ25K7EQ25_HUMAN
Alpha/beta hydrolase domain-contain...
ABHD17A
225Annotation score:
K7ENJ6K7ENJ6_HUMAN
Alpha/beta hydrolase domain-contain...
ABHD17A
39Annotation score:

Sequence cautioni

The sequence BAB15709 differs from that shown. Reason: Erroneous initiation.Curated
The sequence BAB84869 differs from that shown. Reason: Erroneous initiation.Curated
The sequence BAC03419 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti98R → H in AAH00158 (PubMed:15489334).Curated1
Sequence conflicti98R → H in AAH11667 (PubMed:15489334).Curated1
Isoform 2 (identifier: Q96GS6-2)
Sequence conflicti144K → E in AAH20512 (PubMed:15489334).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_027268109G → GARQGHQAQGGHPQLAWVGR LGDSNNPAPGGCLLGKSWGT GAALACGYIHLL in isoform 2. 1 Publication1
Alternative sequenceiVSP_027271177 – 310Missing in isoform 4. 1 PublicationAdd BLAST134
Alternative sequenceiVSP_027269236N → K in isoform 3. 1 Publication1
Alternative sequenceiVSP_027270237 – 310Missing in isoform 3. 1 PublicationAdd BLAST74

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK024419 mRNA Translation: BAB15709.1 Different initiation.
AK074043 mRNA Translation: BAB84869.1 Different initiation.
AK289533 mRNA Translation: BAF82222.1
AK090438 mRNA Translation: BAC03419.1 Different initiation.
AK074548 mRNA Translation: BAC11052.1
CH471139 Genomic DNA Translation: EAW69441.1
CH471139 Genomic DNA Translation: EAW69444.1
CH471139 Genomic DNA Translation: EAW69446.1
BC000158 mRNA Translation: AAH00158.1
BC009256 mRNA Translation: AAH09256.1
BC011667 mRNA Translation: AAH11667.1
BC020512 mRNA Translation: AAH20512.1
BC033749 mRNA Translation: AAH33749.1
BC035961 mRNA Translation: AAH35961.1
BC071644 mRNA Translation: AAH71644.1
BC071876 mRNA Translation: AAH71876.1
BC094816 mRNA Translation: AAH94816.1
CCDSiCCDS32867.1 [Q96GS6-2]
CCDS45902.1 [Q96GS6-1]
RefSeqiNP_001123583.1, NM_001130111.1 [Q96GS6-1]
NP_112490.3, NM_031213.3 [Q96GS6-2]
XP_011526640.1, XM_011528338.1 [Q96GS6-2]
XP_016882830.1, XM_017027341.1
UniGeneiHs.465542
Hs.653679

Genome annotation databases

EnsembliENST00000250974; ENSP00000250974; ENSG00000129968 [Q96GS6-2]
ENST00000292577; ENSP00000292577; ENSG00000129968 [Q96GS6-1]
GeneIDi81926
KEGGihsa:81926
UCSCiuc002luf.4 human [Q96GS6-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK024419 mRNA Translation: BAB15709.1 Different initiation.
AK074043 mRNA Translation: BAB84869.1 Different initiation.
AK289533 mRNA Translation: BAF82222.1
AK090438 mRNA Translation: BAC03419.1 Different initiation.
AK074548 mRNA Translation: BAC11052.1
CH471139 Genomic DNA Translation: EAW69441.1
CH471139 Genomic DNA Translation: EAW69444.1
CH471139 Genomic DNA Translation: EAW69446.1
BC000158 mRNA Translation: AAH00158.1
BC009256 mRNA Translation: AAH09256.1
BC011667 mRNA Translation: AAH11667.1
BC020512 mRNA Translation: AAH20512.1
BC033749 mRNA Translation: AAH33749.1
BC035961 mRNA Translation: AAH35961.1
BC071644 mRNA Translation: AAH71644.1
BC071876 mRNA Translation: AAH71876.1
BC094816 mRNA Translation: AAH94816.1
CCDSiCCDS32867.1 [Q96GS6-2]
CCDS45902.1 [Q96GS6-1]
RefSeqiNP_001123583.1, NM_001130111.1 [Q96GS6-1]
NP_112490.3, NM_031213.3 [Q96GS6-2]
XP_011526640.1, XM_011528338.1 [Q96GS6-2]
XP_016882830.1, XM_017027341.1
UniGeneiHs.465542
Hs.653679

3D structure databases

ProteinModelPortaliQ96GS6
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi123627, 21 interactors
IntActiQ96GS6, 14 interactors
MINTiQ96GS6

Protein family/group databases

ESTHERihuman-ABHD17A ABHD17-depalmitoylase
MEROPSiS09.052

PTM databases

iPTMnetiQ96GS6
PhosphoSitePlusiQ96GS6
SwissPalmiQ96GS6

Polymorphism and mutation databases

BioMutaiABHD17A
DMDMi74751891

Proteomic databases

EPDiQ96GS6
MaxQBiQ96GS6
PeptideAtlasiQ96GS6
PRIDEiQ96GS6
ProteomicsDBi76661
76662 [Q96GS6-2]
76663 [Q96GS6-3]
76664 [Q96GS6-4]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000250974; ENSP00000250974; ENSG00000129968 [Q96GS6-2]
ENST00000292577; ENSP00000292577; ENSG00000129968 [Q96GS6-1]
GeneIDi81926
KEGGihsa:81926
UCSCiuc002luf.4 human [Q96GS6-1]

Organism-specific databases

CTDi81926
EuPathDBiHostDB:ENSG00000129968.15
GeneCardsiABHD17A
H-InvDBiHIX0014598
HIX0028829
HIX0202559
HGNCiHGNC:28756 ABHD17A
HPAiHPA043270
HPA047226
MIMi617942 gene
neXtProtiNX_Q96GS6
OpenTargetsiENSG00000129968
PharmGKBiPA134947443
GenAtlasiSearch...

Phylogenomic databases

GeneTreeiENSGT00390000000948
HOVERGENiHBG061270
InParanoidiQ96GS6
KOiK01076
OMAiTWCCDAF
OrthoDBiEOG091G0EV3
PhylomeDBiQ96GS6
TreeFamiTF314365

Miscellaneous databases

ChiTaRSiABHD17A human
GenomeRNAii81926
PROiPR:Q96GS6
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000129968 Expressed in 92 organ(s), highest expression level in prefrontal cortex
CleanExiHS_FAM108A1
ExpressionAtlasiQ96GS6 baseline and differential
GenevisibleiQ96GS6 HS

Family and domain databases

Gene3Di3.40.50.1820, 1 hit
InterProiView protein in InterPro
IPR029058 AB_hydrolase
IPR022742 Hydrolase_4
PfamiView protein in Pfam
PF12146 Hydrolase_4, 1 hit
SUPFAMiSSF53474 SSF53474, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiAB17A_HUMAN
AccessioniPrimary (citable) accession number: Q96GS6
Secondary accession number(s): A8K0G8
, D6W5Z9, Q6PJU2, Q8WUH9, Q9BWL0, Q9H7Q9
Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 24, 2007
Last sequence update: December 1, 2001
Last modified: October 10, 2018
This is version 141 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. Human chromosome 19
    Human chromosome 19: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again