Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 135 (08 May 2019)
Sequence version 2 (20 Feb 2007)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Probable palmitoyltransferase ZDHHC12

Gene

ZDHHC12

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei127S-palmitoyl cysteine intermediateBy similarity1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionAcyltransferase, Transferase

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Probable palmitoyltransferase ZDHHC12 (EC:2.3.1.225)
Alternative name(s):
Zinc finger DHHC domain-containing protein 12
Short name:
DHHC-12
Zinc finger protein 400
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:ZDHHC12
Synonyms:ZNF400
ORF Names:PSEC0008
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 9

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:19159 ZDHHC12

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q96GR4

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei10 – 30HelicalSequence analysisAdd BLAST21
Transmembranei44 – 64HelicalSequence analysisAdd BLAST21
Transmembranei141 – 161HelicalSequence analysisAdd BLAST21
Transmembranei179 – 199HelicalSequence analysisAdd BLAST21

Keywords - Cellular componenti

Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
84885

Open Targets

More...
OpenTargetsi
ENSG00000160446

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA38802

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
ZDHHC12

Domain mapping of disease mutations (DMDM)

More...
DMDMi
126302619

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002128841 – 267Probable palmitoyltransferase ZDHHC12Add BLAST267

Keywords - PTMi

Lipoprotein, Palmitate

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q96GR4

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q96GR4

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q96GR4

PeptideAtlas

More...
PeptideAtlasi
Q96GR4

PRoteomics IDEntifications database

More...
PRIDEi
Q96GR4

ProteomicsDB human proteome resource

More...
ProteomicsDBi
76657
76658 [Q96GR4-2]
76659 [Q96GR4-3]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q96GR4

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q96GR4

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
Q96GR4

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000160446 Expressed in 118 organ(s), highest expression level in mucosa of transverse colon

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q96GR4 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q96GR4 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA059339

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
124326, 1 interactor

Protein interaction database and analysis system

More...
IntActi
Q96GR4, 2 interactors

Molecular INTeraction database

More...
MINTi
Q96GR4

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000361748

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini97 – 147DHHCPROSITE-ProRule annotationAdd BLAST51

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The DHHC domain is required for palmitoyltransferase activity.By similarity

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the DHHC palmitoyltransferase family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1311 Eukaryota
COG5273 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000156902

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q96GR4

KEGG Orthology (KO)

More...
KOi
K18932

Database of Orthologous Groups

More...
OrthoDBi
1440636at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q96GR4

TreeFam database of animal gene trees

More...
TreeFami
TF329809

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR001594 Palmitoyltrfase_DHHC

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF01529 DHHC, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50216 DHHC, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q96GR4-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAPWALLSPG VLVRTGHTVL TWGITLVLFL HDTELRQWEE QGELLLPLTF
60 70 80 90 100
LLLVLGSLLL YLAVSLMDPG YVNVQPQPQE ELKEEQTAMV PPAIPLRRCR
110 120 130 140 150
YCLVLQPLRA RHCRECRRCV RRYDHHCPWM ENCVGERNHP LFVVYLALQL
160 170 180 190 200
VVLLWGLYLA WSGLRFFQPW GQWLRSSGLL FATFLLLSLF SLVASLLLVS
210 220 230 240 250
HLYLVASNTT TWEFISSHRI AYLRQRPSNP FDRGLTRNLA HFFCGWPSGS
260
WETLWAEEEE EGSSPAV
Length:267
Mass (Da):30,813
Last modified:February 20, 2007 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i7A98B39BDFE43940
GO
Isoform 2 (identifier: Q96GR4-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     189-240: Missing.

Show »
Length:215
Mass (Da):24,884
Checksum:iBC3460C10E72D69E
GO
Isoform 3 (identifier: Q96GR4-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     33-33: T → TDKSADELLATHSHSWNQHLQAFAQPGTHFPTSNCTPTPPTPVLPGPASLCSPASP

Note: No experimental confirmation available.
Show »
Length:322
Mass (Da):36,541
Checksum:i9808BFA50D5F26A7
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
Q5T266Q5T266_HUMAN
Palmitoyltransferase
ZDHHC12
205Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
Q5T269Q5T269_HUMAN
Palmitoyltransferase
ZDHHC12
281Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
X6RBN4X6RBN4_HUMAN
Palmitoyltransferase
ZDHHC12
210Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_02383369P → S. Corresponds to variant dbSNP:rs2298039Ensembl.1
Natural variantiVAR_023834172Q → L4 PublicationsCorresponds to variant dbSNP:rs2900268Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_01627133T → TDKSADELLATHSHSWNQHL QAFAQPGTHFPTSNCTPTPP TPVLPGPASLCSPASP in isoform 3. 1 Publication1
Alternative sequenceiVSP_006945189 – 240Missing in isoform 2. 2 PublicationsAdd BLAST52

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AK027430 mRNA Translation: BAB55104.1
AK075332 mRNA Translation: BAC11553.1
AK315746 mRNA Translation: BAG38100.1
AL441992 Genomic DNA No translation available.
CH471090 Genomic DNA Translation: EAW87826.1
BC009280 mRNA Translation: AAH09280.1
BC048251 mRNA Translation: AAH48251.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS6909.1 [Q96GR4-1]

NCBI Reference Sequences

More...
RefSeqi
NP_001304944.1, NM_001318015.1
NP_001304945.1, NM_001318016.1
NP_001304949.1, NM_001318020.1
NP_001304952.1, NM_001318023.1
NP_116188.2, NM_032799.4 [Q96GR4-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000372663; ENSP00000361748; ENSG00000160446 [Q96GR4-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
84885

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:84885

UCSC genome browser

More...
UCSCi
uc004bvy.4 human [Q96GR4-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK027430 mRNA Translation: BAB55104.1
AK075332 mRNA Translation: BAC11553.1
AK315746 mRNA Translation: BAG38100.1
AL441992 Genomic DNA No translation available.
CH471090 Genomic DNA Translation: EAW87826.1
BC009280 mRNA Translation: AAH09280.1
BC048251 mRNA Translation: AAH48251.1
CCDSiCCDS6909.1 [Q96GR4-1]
RefSeqiNP_001304944.1, NM_001318015.1
NP_001304945.1, NM_001318016.1
NP_001304949.1, NM_001318020.1
NP_001304952.1, NM_001318023.1
NP_116188.2, NM_032799.4 [Q96GR4-1]

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

BioGridi124326, 1 interactor
IntActiQ96GR4, 2 interactors
MINTiQ96GR4
STRINGi9606.ENSP00000361748

PTM databases

iPTMnetiQ96GR4
PhosphoSitePlusiQ96GR4
SwissPalmiQ96GR4

Polymorphism and mutation databases

BioMutaiZDHHC12
DMDMi126302619

Proteomic databases

EPDiQ96GR4
jPOSTiQ96GR4
PaxDbiQ96GR4
PeptideAtlasiQ96GR4
PRIDEiQ96GR4
ProteomicsDBi76657
76658 [Q96GR4-2]
76659 [Q96GR4-3]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
84885
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000372663; ENSP00000361748; ENSG00000160446 [Q96GR4-1]
GeneIDi84885
KEGGihsa:84885
UCSCiuc004bvy.4 human [Q96GR4-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
84885
DisGeNETi84885

GeneCards: human genes, protein and diseases

More...
GeneCardsi
ZDHHC12
HGNCiHGNC:19159 ZDHHC12
HPAiHPA059339
neXtProtiNX_Q96GR4
OpenTargetsiENSG00000160446
PharmGKBiPA38802

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG1311 Eukaryota
COG5273 LUCA
GeneTreeiENSGT00940000156902
InParanoidiQ96GR4
KOiK18932
OrthoDBi1440636at2759
PhylomeDBiQ96GR4
TreeFamiTF329809

Miscellaneous databases

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
84885

Protein Ontology

More...
PROi
PR:Q96GR4

Gene expression databases

BgeeiENSG00000160446 Expressed in 118 organ(s), highest expression level in mucosa of transverse colon
ExpressionAtlasiQ96GR4 baseline and differential
GenevisibleiQ96GR4 HS

Family and domain databases

InterProiView protein in InterPro
IPR001594 Palmitoyltrfase_DHHC
PfamiView protein in Pfam
PF01529 DHHC, 1 hit
PROSITEiView protein in PROSITE
PS50216 DHHC, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiZDH12_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q96GR4
Secondary accession number(s): A6NH95
, B2RE03, Q5T265, Q5T267, Q5T268, Q86VT5, Q96T09
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 1, 2003
Last sequence update: February 20, 2007
Last modified: May 8, 2019
This is version 135 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 9
    Human chromosome 9: entries, gene names and cross-references to MIM
  2. SIMILARITY comments
    Index of protein domains and families
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again