Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Probable palmitoyltransferase ZDHHC12

Gene

ZDHHC12

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at transcript leveli

Functioni

Catalytic activityi

Palmitoyl-CoA + [protein]-L-cysteine = [protein]-S-palmitoyl-L-cysteine + CoA.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Active sitei127S-palmitoyl cysteine intermediateBy similarity1

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionAcyltransferase, Transferase

Names & Taxonomyi

Protein namesi
Recommended name:
Probable palmitoyltransferase ZDHHC12 (EC:2.3.1.225)
Alternative name(s):
Zinc finger DHHC domain-containing protein 12
Short name:
DHHC-12
Zinc finger protein 400
Gene namesi
Name:ZDHHC12
Synonyms:ZNF400
ORF Names:PSEC0008
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 9

Organism-specific databases

EuPathDBiHostDB:ENSG00000160446.18
HGNCiHGNC:19159 ZDHHC12
neXtProtiNX_Q96GR4

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Transmembranei10 – 30HelicalSequence analysisAdd BLAST21
Transmembranei44 – 64HelicalSequence analysisAdd BLAST21
Transmembranei141 – 161HelicalSequence analysisAdd BLAST21
Transmembranei179 – 199HelicalSequence analysisAdd BLAST21

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Organism-specific databases

DisGeNETi84885
OpenTargetsiENSG00000160446
PharmGKBiPA38802

Polymorphism and mutation databases

BioMutaiZDHHC12
DMDMi126302619

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002128841 – 267Probable palmitoyltransferase ZDHHC12Add BLAST267

Keywords - PTMi

Lipoprotein, Palmitate

Proteomic databases

EPDiQ96GR4
PaxDbiQ96GR4
PeptideAtlasiQ96GR4
PRIDEiQ96GR4
ProteomicsDBi76657
76658 [Q96GR4-2]
76659 [Q96GR4-3]

PTM databases

iPTMnetiQ96GR4
PhosphoSitePlusiQ96GR4
SwissPalmiQ96GR4

Expressioni

Gene expression databases

BgeeiENSG00000160446 Expressed in 118 organ(s), highest expression level in mucosa of transverse colon
CleanExiHS_ZDHHC12
ExpressionAtlasiQ96GR4 baseline and differential
GenevisibleiQ96GR4 HS

Organism-specific databases

HPAiHPA059339

Interactioni

Protein-protein interaction databases

BioGridi124326, 1 interactor
IntActiQ96GR4, 2 interactors
MINTiQ96GR4
STRINGi9606.ENSP00000361748

Structurei

3D structure databases

ProteinModelPortaliQ96GR4
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini97 – 147DHHCPROSITE-ProRule annotationAdd BLAST51

Domaini

The DHHC domain is required for palmitoyltransferase activity.By similarity

Sequence similaritiesi

Belongs to the DHHC palmitoyltransferase family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG1311 Eukaryota
COG5273 LUCA
GeneTreeiENSGT00530000063074
HOVERGENiHBG058239
InParanoidiQ96GR4
KOiK18932
PhylomeDBiQ96GR4
TreeFamiTF329809

Family and domain databases

InterProiView protein in InterPro
IPR001594 Palmitoyltrfase_DHHC
PfamiView protein in Pfam
PF01529 DHHC, 1 hit
PROSITEiView protein in PROSITE
PS50216 DHHC, 1 hit

Sequences (3+)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 3 potential isoforms that are computationally mapped.iShow all

Isoform 1 (identifier: Q96GR4-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAPWALLSPG VLVRTGHTVL TWGITLVLFL HDTELRQWEE QGELLLPLTF
60 70 80 90 100
LLLVLGSLLL YLAVSLMDPG YVNVQPQPQE ELKEEQTAMV PPAIPLRRCR
110 120 130 140 150
YCLVLQPLRA RHCRECRRCV RRYDHHCPWM ENCVGERNHP LFVVYLALQL
160 170 180 190 200
VVLLWGLYLA WSGLRFFQPW GQWLRSSGLL FATFLLLSLF SLVASLLLVS
210 220 230 240 250
HLYLVASNTT TWEFISSHRI AYLRQRPSNP FDRGLTRNLA HFFCGWPSGS
260
WETLWAEEEE EGSSPAV
Length:267
Mass (Da):30,813
Last modified:February 20, 2007 - v2
Checksum:i7A98B39BDFE43940
GO
Isoform 2 (identifier: Q96GR4-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     189-240: Missing.

Show »
Length:215
Mass (Da):24,884
Checksum:iBC3460C10E72D69E
GO
Isoform 3 (identifier: Q96GR4-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     33-33: T → TDKSADELLATHSHSWNQHLQAFAQPGTHFPTSNCTPTPPTPVLPGPASLCSPASP

Note: No experimental confirmation available.
Show »
Length:322
Mass (Da):36,541
Checksum:i9808BFA50D5F26A7
GO

Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
Q5T266Q5T266_HUMAN
Palmitoyltransferase
ZDHHC12
205Annotation score:
Q5T269Q5T269_HUMAN
Palmitoyltransferase
ZDHHC12
281Annotation score:
X6RBN4X6RBN4_HUMAN
Palmitoyltransferase
ZDHHC12
210Annotation score:

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_02383369P → S. Corresponds to variant dbSNP:rs2298039Ensembl.1
Natural variantiVAR_023834172Q → L4 PublicationsCorresponds to variant dbSNP:rs2900268Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_01627133T → TDKSADELLATHSHSWNQHL QAFAQPGTHFPTSNCTPTPP TPVLPGPASLCSPASP in isoform 3. 1 Publication1
Alternative sequenceiVSP_006945189 – 240Missing in isoform 2. 2 PublicationsAdd BLAST52

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK027430 mRNA Translation: BAB55104.1
AK075332 mRNA Translation: BAC11553.1
AK315746 mRNA Translation: BAG38100.1
AL441992 Genomic DNA No translation available.
CH471090 Genomic DNA Translation: EAW87826.1
BC009280 mRNA Translation: AAH09280.1
BC048251 mRNA Translation: AAH48251.1
CCDSiCCDS6909.1 [Q96GR4-1]
RefSeqiNP_001304944.1, NM_001318015.1
NP_001304945.1, NM_001318016.1
NP_001304949.1, NM_001318020.1
NP_001304952.1, NM_001318023.1
NP_116188.2, NM_032799.4
UniGeneiHs.133122

Genome annotation databases

EnsembliENST00000372663; ENSP00000361748; ENSG00000160446 [Q96GR4-1]
GeneIDi84885
KEGGihsa:84885
UCSCiuc004bvy.4 human [Q96GR4-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK027430 mRNA Translation: BAB55104.1
AK075332 mRNA Translation: BAC11553.1
AK315746 mRNA Translation: BAG38100.1
AL441992 Genomic DNA No translation available.
CH471090 Genomic DNA Translation: EAW87826.1
BC009280 mRNA Translation: AAH09280.1
BC048251 mRNA Translation: AAH48251.1
CCDSiCCDS6909.1 [Q96GR4-1]
RefSeqiNP_001304944.1, NM_001318015.1
NP_001304945.1, NM_001318016.1
NP_001304949.1, NM_001318020.1
NP_001304952.1, NM_001318023.1
NP_116188.2, NM_032799.4
UniGeneiHs.133122

3D structure databases

ProteinModelPortaliQ96GR4
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi124326, 1 interactor
IntActiQ96GR4, 2 interactors
MINTiQ96GR4
STRINGi9606.ENSP00000361748

PTM databases

iPTMnetiQ96GR4
PhosphoSitePlusiQ96GR4
SwissPalmiQ96GR4

Polymorphism and mutation databases

BioMutaiZDHHC12
DMDMi126302619

Proteomic databases

EPDiQ96GR4
PaxDbiQ96GR4
PeptideAtlasiQ96GR4
PRIDEiQ96GR4
ProteomicsDBi76657
76658 [Q96GR4-2]
76659 [Q96GR4-3]

Protocols and materials databases

DNASUi84885
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000372663; ENSP00000361748; ENSG00000160446 [Q96GR4-1]
GeneIDi84885
KEGGihsa:84885
UCSCiuc004bvy.4 human [Q96GR4-1]

Organism-specific databases

CTDi84885
DisGeNETi84885
EuPathDBiHostDB:ENSG00000160446.18
GeneCardsiZDHHC12
HGNCiHGNC:19159 ZDHHC12
HPAiHPA059339
neXtProtiNX_Q96GR4
OpenTargetsiENSG00000160446
PharmGKBiPA38802
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG1311 Eukaryota
COG5273 LUCA
GeneTreeiENSGT00530000063074
HOVERGENiHBG058239
InParanoidiQ96GR4
KOiK18932
PhylomeDBiQ96GR4
TreeFamiTF329809

Miscellaneous databases

GenomeRNAii84885
PROiPR:Q96GR4

Gene expression databases

BgeeiENSG00000160446 Expressed in 118 organ(s), highest expression level in mucosa of transverse colon
CleanExiHS_ZDHHC12
ExpressionAtlasiQ96GR4 baseline and differential
GenevisibleiQ96GR4 HS

Family and domain databases

InterProiView protein in InterPro
IPR001594 Palmitoyltrfase_DHHC
PfamiView protein in Pfam
PF01529 DHHC, 1 hit
PROSITEiView protein in PROSITE
PS50216 DHHC, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiZDH12_HUMAN
AccessioniPrimary (citable) accession number: Q96GR4
Secondary accession number(s): A6NH95
, B2RE03, Q5T265, Q5T267, Q5T268, Q86VT5, Q96T09
Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 1, 2003
Last sequence update: February 20, 2007
Last modified: September 12, 2018
This is version 129 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again