Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 156 (16 Oct 2019)
Sequence version 1 (01 Dec 2001)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

tRNA (uracil(54)-C(5))-methyltransferase homolog

Gene

TRMT2B

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Probable S-adenosyl-L-methionine-dependent methyltransferase that catalyzes the formation of 5-methyl-uridine at position 54 (m5U54) in all tRNA. May also have a role in tRNA stabilization or maturation (By similarity).By similarity

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the interaction between a single amino acid and another chemical entity. Priority is given to the annotation of physiological ligands.<p><a href='/help/binding' target='_top'>More...</a></p>Binding sitei323S-adenosyl-L-methioninePROSITE-ProRule annotation1
Binding sitei373S-adenosyl-L-methioninePROSITE-ProRule annotation1
Binding sitei423S-adenosyl-L-methioninePROSITE-ProRule annotation1
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei451NucleophilePROSITE-ProRule annotation1
Active sitei497Proton acceptorBy similarity1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionMethyltransferase, Transferase
Biological processtRNA processing
LigandS-adenosyl-L-methionine

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
tRNA (uracil(54)-C(5))-methyltransferase homolog (EC:2.1.1.35)
Alternative name(s):
TRM2 homolog
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:TRMT2B
Synonyms:CXorf34
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome X

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:25748 TRMT2B

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q96GJ1

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

Open Targets

More...
OpenTargetsi
ENSG00000188917

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA164726782

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q96GJ1

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
TRMT2B

Domain mapping of disease mutations (DMDM)

More...
DMDMi
74762656

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003119321 – 504tRNA (uracil(54)-C(5))-methyltransferase homologAdd BLAST504

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q96GJ1

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q96GJ1

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q96GJ1

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q96GJ1

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q96GJ1

PeptideAtlas

More...
PeptideAtlasi
Q96GJ1

PRoteomics IDEntifications database

More...
PRIDEi
Q96GJ1

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
76637 [Q96GJ1-1]
76638 [Q96GJ1-2]
76639 [Q96GJ1-3]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q96GJ1

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q96GJ1

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000188917 Expressed in 164 organ(s), highest expression level in muscle of leg

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q96GJ1 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q96GJ1 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA003745
HPA035120
HPA040814

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

WithEntry#Exp.IntActNotes
P079923EBI-10195625,EBI-750962

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
123044, 16 interactors

Protein interaction database and analysis system

More...
IntActi
Q96GJ1, 9 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000362027

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q96GJ1

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the class I-like SAM-binding methyltransferase superfamily. RNA M5U methyltransferase family.PROSITE-ProRule annotation

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG2187 Eukaryota
COG2265 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00530000063723

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q96GJ1

KEGG Orthology (KO)

More...
KOi
K15331

Identification of Orthologs from Complete Genome Data

More...
OMAi
HEHSNAN

Database of Orthologous Groups

More...
OrthoDBi
248059at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q96GJ1

TreeFam database of animal gene trees

More...
TreeFami
TF352239

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR029063 SAM-dependent_MTases
IPR025823 tRNA_(uracil-5-)_MeTrfase_met
IPR010280 U5_MeTrfase_fam

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF05958 tRNA_U5-meth_tr, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF53335 SSF53335, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS51687 SAM_MT_RNA_M5U, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q96GJ1-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAGLKRRVPL HSLRYFISMV GLFSKPGLLP WYARNPPGWS QLFLGTVCKG
60 70 80 90 100
DFTRVIATKC QKGQKSQKKP SHLGPLDGSW QERLADVVTP LWRLSYEEQL
110 120 130 140 150
KVKFAAQKKI LQRLESYIQM LNGVSVTTAV PKSERLSCLL HPIIPSPVIN
160 170 180 190 200
GYRNKSTFSV NRGPDGNPKT VGFYLGTWRD GNVVCVQSNH LKNIPEKHSQ
210 220 230 240 250
VAQYYEVFLR QSPLEPCLVF HEGGYWRELT VRTNSQGHTM AIITFHPQKL
260 270 280 290 300
SQEELHVQKE IVKEFFIRGP GAACGLTSLY FQESTMTRCS HQQSPYQLLF
310 320 330 340 350
GEPYIFEELL SLKIRISPDA FFQINTAGAE MLYRTVGELT GVNSDTILLD
360 370 380 390 400
ICCGTGVIGL SLAQHTSRVL GIELLEQAVE DARWTAAFNG ITNSEFHTGQ
410 420 430 440 450
AEKILPGLLK SKEDGQSIVA VVNPARAGLH YKVIQAIRNF RAIHTLVFVS
460 470 480 490 500
CKLHGESTRN VIELCCPPDP AKKLLGEPFV LQQAVPVDLF PHTPHCELVL

LFTR
Length:504
Mass (Da):56,476
Last modified:December 1, 2001 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iD7A28E168AC9C366
GO
Isoform 2 (identifier: Q96GJ1-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     464-504: LCCPPDPAKKLLGEPFVLQQAVPVDLFPHTPHCELVLLFTR → RSLILLECSGMVSAHCSLHLPGSSDSPASAS

Note: No experimental confirmation available.
Show »
Length:494
Mass (Da):55,006
Checksum:i22B3CD7F012C136F
GO
Isoform 3 (identifier: Q96GJ1-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     102-146: Missing.

Note: No experimental confirmation available.
Show »
Length:459
Mass (Da):51,485
Checksum:i2000E09C0715483C
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti238H → R in BAB14223 (PubMed:14702039).Curated1
Sequence conflicti451C → R in CAI46112 (PubMed:17974005).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_03735512S → R. Corresponds to variant dbSNP:rs7064613Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_029643102 – 146Missing in isoform 3. 1 PublicationAdd BLAST45
Alternative sequenceiVSP_029644464 – 504LCCPP…LLFTR → RSLILLECSGMVSAHCSLHL PGSSDSPASAS in isoform 2. 1 PublicationAdd BLAST41

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AK022749 mRNA Translation: BAB14223.1
AL832849 mRNA Translation: CAI46112.1
AL109952 Genomic DNA No translation available.
AL133275 Genomic DNA No translation available.
Z97985 Genomic DNA No translation available.
CH471115 Genomic DNA Translation: EAX02831.1
CH471115 Genomic DNA Translation: EAX02837.1
BC007526 mRNA Translation: AAH07526.1
BC008067 mRNA Translation: AAH08067.2
BC009437 mRNA Translation: AAH09437.1
BC020116 mRNA Translation: AAH20116.1
BC034272 mRNA Translation: AAH34272.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS14477.1 [Q96GJ1-1]
CCDS55464.1 [Q96GJ1-3]

NCBI Reference Sequences

More...
RefSeqi
NP_001161442.1, NM_001167970.1 [Q96GJ1-1]
NP_001161443.1, NM_001167971.1 [Q96GJ1-3]
NP_001161444.1, NM_001167972.1 [Q96GJ1-1]
NP_079193.2, NM_024917.5 [Q96GJ1-1]
XP_005262252.1, XM_005262195.2 [Q96GJ1-1]
XP_005262253.1, XM_005262196.2 [Q96GJ1-1]
XP_006724768.1, XM_006724705.2 [Q96GJ1-1]
XP_016885351.1, XM_017029862.1 [Q96GJ1-3]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000372935; ENSP00000362026; ENSG00000188917 [Q96GJ1-1]
ENST00000372936; ENSP00000362027; ENSG00000188917 [Q96GJ1-1]
ENST00000372939; ENSP00000362030; ENSG00000188917 [Q96GJ1-3]
ENST00000545398; ENSP00000438134; ENSG00000188917 [Q96GJ1-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
79979

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:79979

UCSC genome browser

More...
UCSCi
uc004egq.4 human [Q96GJ1-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK022749 mRNA Translation: BAB14223.1
AL832849 mRNA Translation: CAI46112.1
AL109952 Genomic DNA No translation available.
AL133275 Genomic DNA No translation available.
Z97985 Genomic DNA No translation available.
CH471115 Genomic DNA Translation: EAX02831.1
CH471115 Genomic DNA Translation: EAX02837.1
BC007526 mRNA Translation: AAH07526.1
BC008067 mRNA Translation: AAH08067.2
BC009437 mRNA Translation: AAH09437.1
BC020116 mRNA Translation: AAH20116.1
BC034272 mRNA Translation: AAH34272.1
CCDSiCCDS14477.1 [Q96GJ1-1]
CCDS55464.1 [Q96GJ1-3]
RefSeqiNP_001161442.1, NM_001167970.1 [Q96GJ1-1]
NP_001161443.1, NM_001167971.1 [Q96GJ1-3]
NP_001161444.1, NM_001167972.1 [Q96GJ1-1]
NP_079193.2, NM_024917.5 [Q96GJ1-1]
XP_005262252.1, XM_005262195.2 [Q96GJ1-1]
XP_005262253.1, XM_005262196.2 [Q96GJ1-1]
XP_006724768.1, XM_006724705.2 [Q96GJ1-1]
XP_016885351.1, XM_017029862.1 [Q96GJ1-3]

3D structure databases

SMRiQ96GJ1
ModBaseiSearch...

Protein-protein interaction databases

BioGridi123044, 16 interactors
IntActiQ96GJ1, 9 interactors
STRINGi9606.ENSP00000362027

PTM databases

iPTMnetiQ96GJ1
PhosphoSitePlusiQ96GJ1

Polymorphism and mutation databases

BioMutaiTRMT2B
DMDMi74762656

Proteomic databases

EPDiQ96GJ1
jPOSTiQ96GJ1
MassIVEiQ96GJ1
MaxQBiQ96GJ1
PaxDbiQ96GJ1
PeptideAtlasiQ96GJ1
PRIDEiQ96GJ1
ProteomicsDBi76637 [Q96GJ1-1]
76638 [Q96GJ1-2]
76639 [Q96GJ1-3]

Genome annotation databases

EnsembliENST00000372935; ENSP00000362026; ENSG00000188917 [Q96GJ1-1]
ENST00000372936; ENSP00000362027; ENSG00000188917 [Q96GJ1-1]
ENST00000372939; ENSP00000362030; ENSG00000188917 [Q96GJ1-3]
ENST00000545398; ENSP00000438134; ENSG00000188917 [Q96GJ1-1]
GeneIDi79979
KEGGihsa:79979
UCSCiuc004egq.4 human [Q96GJ1-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
79979

GeneCards: human genes, protein and diseases

More...
GeneCardsi
TRMT2B
HGNCiHGNC:25748 TRMT2B
HPAiHPA003745
HPA035120
HPA040814
neXtProtiNX_Q96GJ1
OpenTargetsiENSG00000188917
PharmGKBiPA164726782

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG2187 Eukaryota
COG2265 LUCA
GeneTreeiENSGT00530000063723
InParanoidiQ96GJ1
KOiK15331
OMAiHEHSNAN
OrthoDBi248059at2759
PhylomeDBiQ96GJ1
TreeFamiTF352239

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
TRMT2B human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
79979
PharosiQ96GJ1

Protein Ontology

More...
PROi
PR:Q96GJ1

Gene expression databases

BgeeiENSG00000188917 Expressed in 164 organ(s), highest expression level in muscle of leg
ExpressionAtlasiQ96GJ1 baseline and differential
GenevisibleiQ96GJ1 HS

Family and domain databases

InterProiView protein in InterPro
IPR029063 SAM-dependent_MTases
IPR025823 tRNA_(uracil-5-)_MeTrfase_met
IPR010280 U5_MeTrfase_fam
PfamiView protein in Pfam
PF05958 tRNA_U5-meth_tr, 1 hit
SUPFAMiSSF53335 SSF53335, 1 hit
PROSITEiView protein in PROSITE
PS51687 SAM_MT_RNA_M5U, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiTRM2_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q96GJ1
Secondary accession number(s): A6NDG5
, A6NEI9, A6NMG6, Q5JPF0, Q5JVY6, Q96HU7, Q96IH9, Q9H9K2
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: December 4, 2007
Last sequence update: December 1, 2001
Last modified: October 16, 2019
This is version 156 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome X
    Human chromosome X: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. SIMILARITY comments
    Index of protein domains and families
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again