Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - Q96GD4 (AURKB_HUMAN)

Entry version 219 (10 Feb 2021)
Sequence version 3 (11 Jan 2011)
Previous versions | rss
Add a publicationFeedback
Protein

Aurora kinase B

Gene

AURKB

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Serine/threonine-protein kinase component of the chromosomal passenger complex (CPC), a complex that acts as a key regulator of mitosis. The CPC complex has essential functions at the centromere in ensuring correct chromosome alignment and segregation and is required for chromatin-induced microtubule stabilization and spindle assembly. Involved in the bipolar attachment of spindle microtubules to kinetochores and is a key regulator for the onset of cytokinesis during mitosis. Required for central/midzone spindle assembly and cleavage furrow formation. Key component of the cytokinesis checkpoint, a process required to delay abscission to prevent both premature resolution of intercellular chromosome bridges and accumulation of DNA damage: phosphorylates CHMP4C, leading to retain abscission-competent VPS4 (VPS4A and/or VPS4B) at the midbody ring until abscission checkpoint signaling is terminated at late cytokinesis (PubMed:22422861, PubMed:24814515). AURKB phosphorylates the CPC complex subunits BIRC5/survivin, CDCA8/borealin and INCENP. Phosphorylation of INCENP leads to increased AURKB activity. Other known AURKB substrates involved in centromeric functions and mitosis are CENPA, DES/desmin, GPAF, KIF2C, NSUN2, RACGAP1, SEPTIN1, VIM/vimentin, HASPIN, and histone H3. A positive feedback loop involving HASPIN and AURKB contributes to localization of CPC to centromeres. Phosphorylation of VIM controls vimentin filament segregation in cytokinetic process, whereas histone H3 is phosphorylated at 'Ser-10' and 'Ser-28' during mitosis (H3S10ph and H3S28ph, respectively). A positive feedback between HASPIN and AURKB contributes to CPC localization. AURKB is also required for kinetochore localization of BUB1 and SGO1. Phosphorylation of p53/TP53 negatively regulates its transcriptional activity. Key regulator of active promoters in resting B- and T-lymphocytes: acts by mediating phosphorylation of H3S28ph at active promoters in resting B-cells, inhibiting RNF2/RING1B-mediated ubiquitination of histone H2A and enhancing binding and activity of the USP16 deubiquitinase at transcribed genes.19 Publications

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>This subsection of the 'Function' section provides information relevant to cofactors. A cofactor is any non-protein substance required for a protein to be catalytically active. Some cofactors are inorganic, such as the metal atoms zinc, iron, and copper in various oxidation states. Others, such as most vitamins, are organic.<p><a href='/help/cofactor' target='_top'>More...</a></p>Cofactori

Mg2+

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes regulatory mechanisms for enzymes, transporters or microbial transcription factors, and reports the components which regulate (by activation or inhibition) the reaction.<p><a href='/help/activity_regulation' target='_top'>More...</a></p>Activity regulationi

Activity is greatly increased when AURKB is within the CPC complex. In particular, AURKB-phosphorylated INCENP acts as an activator of AURKB. Positive feedback between HASPIN and AURKB contributes to CPC localization.3 Publications

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the interaction between a single amino acid and another chemical entity. Priority is given to the annotation of physiological ligands.<p><a href='/help/binding' target='_top'>More...</a></p>Binding sitei106ATPPROSITE-ProRule annotation1
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei200Proton acceptorPROSITE-ProRule annotation1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes a region in the protein which binds nucleotide phosphates. It always involves more than one amino acid and includes all residues involved in nucleotide-binding.<p><a href='/help/np_bind' target='_top'>More...</a></p>Nucleotide bindingi83 – 91ATPPROSITE-ProRule annotation9

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionKinase, Serine/threonine-protein kinase, Transferase
Biological processCell cycle, Cell division, Mitosis
LigandATP-binding, Magnesium, Metal-binding, Nucleotide-binding

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		Q96GD4

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-141444, Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal
R-HSA-174178, APC/C:Cdh1 mediated degradation of Cdc20 and other APC/C:Cdh1 targeted proteins in late mitosis/early G1
R-HSA-2467813, Separation of Sister Chromatids
R-HSA-2500257, Resolution of Sister Chromatid Cohesion
R-HSA-4615885, SUMOylation of DNA replication proteins
R-HSA-5663220, RHO GTPases Activate Formins
R-HSA-6804756, Regulation of TP53 Activity through Phosphorylation
R-HSA-68877, Mitotic Prometaphase
R-HSA-9022692, Regulation of MECP2 expression and activity
R-HSA-9648025, EML4 and NUDC in mitotic spindle formation

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...SignaLinki		Q96GD4

SIGNOR Signaling Network Open Resource

More...SIGNORi		Q96GD4

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Aurora kinase B (EC:2.7.11.1)
Alternative name(s):
Aurora 1
Aurora- and IPL1-like midbody-associated protein 1
Short name:
AIM-1
Aurora/IPL1-related kinase 2
Short name:
ARK-2
Short name:
Aurora-related kinase 2
STK-1
Serine/threonine-protein kinase 12
Serine/threonine-protein kinase 5
Serine/threonine-protein kinase aurora-B
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:AURKB
Synonyms:AIK2, AIM1, AIRK2, ARK2, STK1, STK12, STK5
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 17

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:11390, AURKB

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		604970, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_Q96GD4

Eukaryotic Pathogen, Vector and Host Database Resources

More...VEuPathDBi		HostDB:ENSG00000178999.12

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Centromere, Chromosome, Cytoplasm, Cytoskeleton, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the 'Pathology and Biotech' section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

Disruptive regulation of expression is a possible mechanism of the perturbation of chromosomal integrity in cancer cells through its dominant-negative effect on cytokinesis.

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology%5Fand%5Fbiotech%5Fsection">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi106K → R: Leads to loss of kinase activity and severely impairs mitotic progression. 4 Publications1

Organism-specific databases

DisGeNET

More...DisGeNETi		9212

Open Targets

More...OpenTargetsi		ENSG00000178999

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA36199

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		Q96GD4, Tchem

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...ChEMBLi		CHEMBL2185

Drug and drug target database

More...DrugBanki		DB05169, AT9283
DB06486, Enzastaurin
DB12010, Fostamatinib
DB04703, Hesperidin
DB07340, Reversine

DrugCentral

More...DrugCentrali		Q96GD4

IUPHAR/BPS Guide to PHARMACOLOGY

More...GuidetoPHARMACOLOGYi		1937

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		AURKB

Domain mapping of disease mutations (DMDM)

More...DMDMi		317373473

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000856561 – 344Aurora kinase BAdd BLAST344

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei35PhosphothreonineCombined sources1
Modified residuei62PhosphoserineCombined sources1
Modified residuei64PhosphothreonineCombined sources1
Modified residuei227PhosphoserineCombined sources1
Modified residuei232Phosphothreonine; by autocatalysis1 Publication1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

The phosphorylation of Thr-232 requires the binding to INCENP and occurs by means of an autophosphorylation mechanism. Thr-232 phosphorylation is indispensable for the AURKB kinase activity.1 Publication
Ubiquitinated by different BCR (BTB-CUL3-RBX1) E3 ubiquitin ligase complexes. Ubiquitinated by the BCR(KLHL9-KLHL13) E3 ubiquitin ligase complex, ubiquitination leads to removal from mitotic chromosomes and is required for cytokinesis. During anaphase, the BCR(KLHL21) E3 ubiquitin ligase complex recruits the CPC complex from chromosomes to the spindle midzone and mediates the ubiquitination of AURKB. Ubiquitination of AURKB by BCR(KLHL21) E3 ubiquitin ligase complex may not lead to its degradation by the proteasome.2 Publications

Keywords - PTMi

Phosphoprotein, Ubl conjugation

Proteomic databases

The CPTAC Assay portal

More...CPTACi		CPTAC-1219
CPTAC-1228
CPTAC-1340

Encyclopedia of Proteome Dynamics

More...EPDi		Q96GD4

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		Q96GD4

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		Q96GD4

MaxQB - The MaxQuant DataBase

More...MaxQBi		Q96GD4

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q96GD4

PeptideAtlas

More...PeptideAtlasi		Q96GD4

PRoteomics IDEntifications database

More...PRIDEi		Q96GD4

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		4709
7611
76623 [Q96GD4-1]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q96GD4

MetOSite database of methionine sulfoxide sites

More...MetOSitei		Q96GD4

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q96GD4

SwissPalm database of S-palmitoylation events

More...SwissPalmi		Q96GD4

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

High level expression seen in the thymus. It is also expressed in the spleen, lung, testis, colon, placenta and fetal liver. Expressed during S and G2/M phase and expression is up-regulated in cancer cells during M phase.2 Publications

<p>This subsection of the 'Expression' section reports the experimentally proven effects of inducers and repressors (usually chemical compounds or environmental factors) on the level of protein (or mRNA) expression (up-regulation, down-regulation, constitutive expression).<p><a href='/help/induction' target='_top'>More...</a></p>Inductioni

Expression is cell cycle-regulated, with a low in G1/S, an increase during G2 and M. Expression decreases again after M phase.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000178999, Expressed in ventricular zone and 155 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		Q96GD4, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q96GD4, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000178999, Tissue enhanced (bone marrow, lymphoid tissue)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Component of the chromosomal passenger complex (CPC) composed of at least BIRC5/survivin, CDCA8/borealin, INCENP, AURKB or AURKC; predominantly independent AURKB- and AURKC-containing complexes exist. Associates with RACGAP1 during M phase.

Interacts with CDCA1, EVI5, JTB, NDC80, PSMA3, SEPTIN1, SIRT2 and TACC1.

Interacts with SPDYC; this interaction may be required for proper localization of active, Thr-232-phosphorylated AURKB form during prometaphase and metaphase.

Interacts with p53/TP53.

Interacts (via the middle kinase domain) with NOC2L (via the N- and C-terminus domains).

Interacts with TTC28.

Interacts with RNF2/RING1B.

19 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

GO - Molecular functioni

Complete GO annotation on QuickGO ...

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		114646, 217 interactors

ComplexPortal: manually curated resource of macromolecular complexes

More...ComplexPortali		CPX-116, Chromosomal passenger complex

CORUM comprehensive resource of mammalian protein complexes

More...CORUMi		Q96GD4

Database of interacting proteins

More...DIPi		DIP-34530N

The Eukaryotic Linear Motif resource for Functional Sites in Proteins

More...ELMi		Q96GD4

Protein interaction database and analysis system

More...IntActi		Q96GD4, 97 interactors

Molecular INTeraction database

More...MINTi		Q96GD4

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000313950

Chemistry databases

BindingDB database of measured binding affinities

More...BindingDBi		Q96GD4

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		Q96GD4, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1344
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		Q96GD4

Database of comparative protein structure models

More...ModBasei		Search...

Protein Data Bank in Europe - Knowledge Base

More...PDBe-KBi		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini77 – 327Protein kinasePROSITE-ProRule annotationAdd BLAST251

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the protein kinase superfamily. Ser/Thr protein kinase family. Aurora subfamily.PROSITE-ProRule annotation

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG0580, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00940000158980

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q96GD4

Identification of Orthologs from Complete Genome Data

More...OMAi		WPYGRQM

Database of Orthologous Groups

More...OrthoDBi		954262at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q96GD4

TreeFam database of animal gene trees

More...TreeFami		TF351439

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR030616, Aur
IPR028772, AURKB
IPR011009, Kinase-like_dom_sf
IPR000719, Prot_kinase_dom
IPR017441, Protein_kinase_ATP_BS
IPR008271, Ser/Thr_kinase_AS

The PANTHER Classification System

More...PANTHERi		PTHR24350, PTHR24350, 1 hit
PTHR24350:SF4, PTHR24350:SF4, 1 hit

Pfam protein domain database

More...Pfami		View protein in Pfam
PF00069, Pkinase, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00220, S_TKc, 1 hit

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF56112, SSF56112, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS00107, PROTEIN_KINASE_ATP, 1 hit
PS50011, PROTEIN_KINASE_DOM, 1 hit
PS00108, PROTEIN_KINASE_ST, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 5 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 6 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q96GD4-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAQKENSYPW PYGRQTAPSG LSTLPQRVLR KEPVTPSALV LMSRSNVQPT 
        60         70         80         90        100
AAPGQKVMEN SSGTPDILTR HFTIDDFEIG RPLGKGKFGN VYLAREKKSH 
       110        120        130        140        150
FIVALKVLFK SQIEKEGVEH QLRREIEIQA HLHHPNILRL YNYFYDRRRI 
       160        170        180        190        200
YLILEYAPRG ELYKELQKSC TFDEQRTATI MEELADALMY CHGKKVIHRD 
       210        220        230        240        250
IKPENLLLGL KGELKIADFG WSVHAPSLRR KTMCGTLDYL PPEMIEGRMH 
       260        270        280        290        300
NEKVDLWCIG VLCYELLVGN PPFESASHNE TYRRIVKVDL KFPASVPMGA 
       310        320        330        340 
QDLISKLLRH NPSERLPLAQ VSAHPWVRAN SRRVLPPSAL QSVA
Length:344
Mass (Da):39,311
Last modified:January 11, 2011 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iA5ED13EF5A1FAFBF
GO
Isoform 2 (identifier: Q96GD4-2) [UniParc]FASTAAdd to basket
Also known as: aurkb-sv1

The sequence of this isoform differs from the canonical sequence as follows:
     86-134: GKFGNVYLAREKKSHFIVALKVLFKSQIEKEGVEHQLRREIEIQAHLHH → ALLCLWPEASSVSSPSH

Show »
Length:312
Mass (Da):35,302
Checksum:i9499DAE479793112
GO
Isoform 3 (identifier: Q96GD4-3) [UniParc]FASTAAdd to basket
Also known as: aurkb-sv2

The sequence of this isoform differs from the canonical sequence as follows:
     69-69: T → TR
     133-141: HHPNILRLY → QSWRSWQML
     142-344: Missing.

Note: Not expressed in normal liver, high expression in metastatic liver.Curated
Show »
Length:142
Mass (Da):16,211
Checksum:iD8AB62DA2CCFA385
GO
Isoform 4 (identifier: Q96GD4-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-41: Missing.

Show »
Length:303
Mass (Da):34,760
Checksum:i301BAFF2494B3650
GO
Isoform 5 (identifier: Q96GD4-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     69-69: T → TR

Show »
Length:345
Mass (Da):39,467
Checksum:iACB05C191F35F38C
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 6 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
J3KTD6J3KTD6_HUMAN
Aurora kinase
AURKB
228Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
J3QLN8J3QLN8_HUMAN
Aurora kinase
AURKB
230Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
J3QR41J3QR41_HUMAN
Aurora kinase
AURKB
172Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
J3KT86J3KT86_HUMAN
Aurora kinase
AURKB
242Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
J3KRJ2J3KRJ2_HUMAN
Aurora kinase
AURKB
69Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
J3KRF8J3KRF8_HUMAN
Aurora kinase
AURKB
123Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAH13300 differs from that shown. Reason: Erroneous initiation. Extended N-terminus.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti14 – 15RQ → DK in AAC98891 (Ref. 5) Curated2
Sequence conflicti161E → M in AAB65786 (PubMed:11471245).Curated1
Sequence conflicti161E → M in AAC98891 (Ref. 5) Curated1
Sequence conflicti167 – 169QKS → HKT in AAB65786 (PubMed:11471245).Curated3
Sequence conflicti179T → TVRR in AAB65786 (PubMed:11471245).Curated1
Sequence conflicti180I → VRAV in AAC98891 (Ref. 5) Curated1
Sequence conflicti226P → T in BAA82709 (PubMed:9858806).Curated1
Sequence conflicti249 – 250MH → ID in BAA82709 (PubMed:9858806).Curated2
Sequence conflicti271Missing in BAA82709 (PubMed:9858806).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_04038352A → V1 PublicationCorresponds to variant dbSNP:rs55878091Ensembl.1
Natural variantiVAR_027970100H → Q. Corresponds to variant dbSNP:rs3027254Ensembl.1
Natural variantiVAR_040384179T → M1 PublicationCorresponds to variant dbSNP:rs55871613Ensembl.1
Natural variantiVAR_027971298M → T8 PublicationsCorresponds to variant dbSNP:rs1059476Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0471031 – 41Missing in isoform 4. 1 PublicationAdd BLAST41
Alternative sequenceiVSP_04438469T → TR in isoform 3 and isoform 5. 2 Publications1
Alternative sequenceiVSP_04438586 – 134GKFGN…AHLHH → ALLCLWPEASSVSSPSH in isoform 2. 1 PublicationAdd BLAST49
Alternative sequenceiVSP_044386133 – 141HHPNILRLY → QSWRSWQML in isoform 3. 1 Publication9
Alternative sequenceiVSP_044387142 – 344Missing in isoform 3. 1 PublicationAdd BLAST203

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AF008552 mRNA Translation: AAC12709.1
AB011450 mRNA Translation: BAA32136.1
AB011446 mRNA Translation: BAA82709.1
AF004022 mRNA Translation: AAB65786.1
AF015254 mRNA Translation: AAC98891.1
AB519677 mRNA Translation: BAI23190.1
AB519678 mRNA Translation: BAI23191.1
AB519679 mRNA Translation: BAI23192.1
BT019534 mRNA Translation: AAV38341.1
AK297976 mRNA Translation: BAG60286.1
AC135178 Genomic DNA No translation available.
CH471108 Genomic DNA Translation: EAW90075.1
CH471108 Genomic DNA Translation: EAW90077.1
CH471108 Genomic DNA Translation: EAW90078.1
BC000442 mRNA Translation: AAH00442.3
BC009751 mRNA Translation: AAH09751.1
BC013300 mRNA Translation: AAH13300.2 Different initiation.
BC080581 mRNA Translation: AAH80581.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS11134.1 [Q96GD4-1]
CCDS58514.1 [Q96GD4-4]
CCDS67162.1 [Q96GD4-5]
CCDS82065.1 [Q96GD4-2]

NCBI Reference Sequences

More...RefSeqi		NP_001243763.1, NM_001256834.2 [Q96GD4-4]
NP_001271455.1, NM_001284526.1 [Q96GD4-5]
NP_001300879.1, NM_001313950.1 [Q96GD4-1]
NP_001300880.1, NM_001313951.1 [Q96GD4-4]
NP_001300881.1, NM_001313952.1
NP_001300882.1, NM_001313953.1 [Q96GD4-2]
NP_001300883.1, NM_001313954.1
NP_001300884.1, NM_001313955.1
NP_004208.2, NM_004217.3 [Q96GD4-1]
XP_011522372.1, XM_011524070.2
XP_011522374.1, XM_011524072.2 [Q96GD4-4]
XP_016880796.1, XM_017025307.1 [Q96GD4-4]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000316199; ENSP00000313950; ENSG00000178999 [Q96GD4-5]
ENST00000534871; ENSP00000443869; ENSG00000178999 [Q96GD4-4]
ENST00000578549; ENSP00000462207; ENSG00000178999 [Q96GD4-2]
ENST00000585124; ENSP00000463999; ENSG00000178999 [Q96GD4-1]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		9212

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:9212

UCSC genome browser

More...UCSCi		uc002gkm.5, human [Q96GD4-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF008552 mRNA Translation: AAC12709.1
AB011450 mRNA Translation: BAA32136.1
AB011446 mRNA Translation: BAA82709.1
AF004022 mRNA Translation: AAB65786.1
AF015254 mRNA Translation: AAC98891.1
AB519677 mRNA Translation: BAI23190.1
AB519678 mRNA Translation: BAI23191.1
AB519679 mRNA Translation: BAI23192.1
BT019534 mRNA Translation: AAV38341.1
AK297976 mRNA Translation: BAG60286.1
AC135178 Genomic DNA No translation available.
CH471108 Genomic DNA Translation: EAW90075.1
CH471108 Genomic DNA Translation: EAW90077.1
CH471108 Genomic DNA Translation: EAW90078.1
BC000442 mRNA Translation: AAH00442.3
BC009751 mRNA Translation: AAH09751.1
BC013300 mRNA Translation: AAH13300.2 Different initiation.
BC080581 mRNA Translation: AAH80581.1
CCDSiCCDS11134.1 [Q96GD4-1]
CCDS58514.1 [Q96GD4-4]
CCDS67162.1 [Q96GD4-5]
CCDS82065.1 [Q96GD4-2]
RefSeqiNP_001243763.1, NM_001256834.2 [Q96GD4-4]
NP_001271455.1, NM_001284526.1 [Q96GD4-5]
NP_001300879.1, NM_001313950.1 [Q96GD4-1]
NP_001300880.1, NM_001313951.1 [Q96GD4-4]
NP_001300881.1, NM_001313952.1
NP_001300882.1, NM_001313953.1 [Q96GD4-2]
NP_001300883.1, NM_001313954.1
NP_001300884.1, NM_001313955.1
NP_004208.2, NM_004217.3 [Q96GD4-1]
XP_011522372.1, XM_011524070.2
XP_011522374.1, XM_011524072.2 [Q96GD4-4]
XP_016880796.1, XM_017025307.1 [Q96GD4-4]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...PDBei

Protein Data Bank RCSB

More...RCSB PDBi

Protein Data Bank Japan

More...PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
4AF3X-ray2.75A55-344[»]
SMRiQ96GD4
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGRIDi114646, 217 interactors
ComplexPortaliCPX-116, Chromosomal passenger complex
CORUMiQ96GD4
DIPiDIP-34530N
ELMiQ96GD4
IntActiQ96GD4, 97 interactors
MINTiQ96GD4
STRINGi9606.ENSP00000313950

Chemistry databases

BindingDBiQ96GD4
ChEMBLiCHEMBL2185
DrugBankiDB05169, AT9283
DB06486, Enzastaurin
DB12010, Fostamatinib
DB04703, Hesperidin
DB07340, Reversine
DrugCentraliQ96GD4
GuidetoPHARMACOLOGYi1937

PTM databases

iPTMnetiQ96GD4
MetOSiteiQ96GD4
PhosphoSitePlusiQ96GD4
SwissPalmiQ96GD4

Genetic variation databases

BioMutaiAURKB
DMDMi317373473

Proteomic databases

CPTACiCPTAC-1219
CPTAC-1228
CPTAC-1340
EPDiQ96GD4
jPOSTiQ96GD4
MassIVEiQ96GD4
MaxQBiQ96GD4
PaxDbiQ96GD4
PeptideAtlasiQ96GD4
PRIDEiQ96GD4
ProteomicsDBi4709
7611
76623 [Q96GD4-1]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		3128, 1048 antibodies

The DNASU plasmid repository

More...DNASUi		9212

Genome annotation databases

EnsembliENST00000316199; ENSP00000313950; ENSG00000178999 [Q96GD4-5]
ENST00000534871; ENSP00000443869; ENSG00000178999 [Q96GD4-4]
ENST00000578549; ENSP00000462207; ENSG00000178999 [Q96GD4-2]
ENST00000585124; ENSP00000463999; ENSG00000178999 [Q96GD4-1]
GeneIDi9212
KEGGihsa:9212
UCSCiuc002gkm.5, human [Q96GD4-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		9212
DisGeNETi9212

GeneCards: human genes, protein and diseases

More...GeneCardsi		AURKB
HGNCiHGNC:11390, AURKB
HPAiENSG00000178999, Tissue enhanced (bone marrow, lymphoid tissue)
MIMi604970, gene
neXtProtiNX_Q96GD4
OpenTargetsiENSG00000178999
PharmGKBiPA36199
VEuPathDBiHostDB:ENSG00000178999.12

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG0580, Eukaryota
GeneTreeiENSGT00940000158980
InParanoidiQ96GD4
OMAiWPYGRQM
OrthoDBi954262at2759
PhylomeDBiQ96GD4
TreeFamiTF351439

Enzyme and pathway databases

PathwayCommonsiQ96GD4
ReactomeiR-HSA-141444, Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal
R-HSA-174178, APC/C:Cdh1 mediated degradation of Cdc20 and other APC/C:Cdh1 targeted proteins in late mitosis/early G1
R-HSA-2467813, Separation of Sister Chromatids
R-HSA-2500257, Resolution of Sister Chromatid Cohesion
R-HSA-4615885, SUMOylation of DNA replication proteins
R-HSA-5663220, RHO GTPases Activate Formins
R-HSA-6804756, Regulation of TP53 Activity through Phosphorylation
R-HSA-68877, Mitotic Prometaphase
R-HSA-9022692, Regulation of MECP2 expression and activity
R-HSA-9648025, EML4 and NUDC in mitotic spindle formation
SignaLinkiQ96GD4
SIGNORiQ96GD4

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		9212, 784 hits in 920 CRISPR screens

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		Aurora_B_kinase

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		9212
PharosiQ96GD4, Tchem

Protein Ontology

More...PROi		PR:Q96GD4
RNActiQ96GD4, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000178999, Expressed in ventricular zone and 155 other tissues
ExpressionAtlasiQ96GD4, baseline and differential
GenevisibleiQ96GD4, HS

Family and domain databases

InterProiView protein in InterPro
IPR030616, Aur
IPR028772, AURKB
IPR011009, Kinase-like_dom_sf
IPR000719, Prot_kinase_dom
IPR017441, Protein_kinase_ATP_BS
IPR008271, Ser/Thr_kinase_AS
PANTHERiPTHR24350, PTHR24350, 1 hit
PTHR24350:SF4, PTHR24350:SF4, 1 hit
PfamiView protein in Pfam
PF00069, Pkinase, 1 hit
SMARTiView protein in SMART
SM00220, S_TKc, 1 hit
SUPFAMiSSF56112, SSF56112, 1 hit
PROSITEiView protein in PROSITE
PS00107, PROTEIN_KINASE_ATP, 1 hit
PS50011, PROTEIN_KINASE_DOM, 1 hit
PS00108, PROTEIN_KINASE_ST, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiAURKB_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q96GD4
Secondary accession number(s): B4DNM4
, C7G533, C7G534, C7G535, D3DTR4, J9JID1, O14630, O60446, O95083, Q96DV5, Q9UQ46
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: January 17, 2003
Last sequence update: January 11, 2011
Last modified: February 10, 2021
This is version 219 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Reference proteome

Documents

  1. Human and mouse protein kinases
    Human and mouse protein kinases: classification and index
  2. Human chromosome 17
    Human chromosome 17: entries, gene names and cross-references to MIM
  3. Human entries with genetic variants
    List of human entries with genetic variants
  4. Human variants curated from literature reports
    Index of human variants curated from literature reports
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  6. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  7. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again