Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 145 (22 Apr 2020)
Sequence version 2 (15 May 2007)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Tetraspanin-17

Gene

TSPAN17

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Regulates ADAM10 maturation.By similarity

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Tetraspanin-17
Short name:
Tspan-17
Alternative name(s):
F-box only protein 23
Tetraspan protein SB134
Transmembrane 4 superfamily member 17
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:TSPAN17
Synonyms:FBXO23, TM4SF17
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 5

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:13594 TSPAN17

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q96FV3

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini1 – 19CytoplasmicSequence analysisAdd BLAST19
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei20 – 40HelicalSequence analysisAdd BLAST21
Topological domaini41 – 63ExtracellularSequence analysisAdd BLAST23
Transmembranei64 – 84HelicalSequence analysisAdd BLAST21
Topological domaini85 – 94CytoplasmicSequence analysis10
Transmembranei95 – 115HelicalSequence analysisAdd BLAST21
Topological domaini116 – 234ExtracellularSequence analysisAdd BLAST119
Transmembranei235 – 255HelicalSequence analysisAdd BLAST21
Topological domaini256 – 270CytoplasmicSequence analysisAdd BLAST15

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

Open Targets

More...
OpenTargetsi
ENSG00000048140

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA128394740

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q96FV3 Tdark

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
TSPAN17

Domain mapping of disease mutations (DMDM)

More...
DMDMi
147744595

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002192651 – 270Tetraspanin-17Add BLAST270

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi51N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi171N-linked (GlcNAc...) asparagineSequence analysis1

Keywords - PTMi

Glycoprotein

Proteomic databases

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q96FV3

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q96FV3

PeptideAtlas

More...
PeptideAtlasi
Q96FV3

PRoteomics IDEntifications database

More...
PRIDEi
Q96FV3

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
76560 [Q96FV3-1]
76561 [Q96FV3-2]
76562 [Q96FV3-3]
76563 [Q96FV3-4]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q96FV3

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000048140 Expressed in prostate gland and 193 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q96FV3 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q96FV3 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000048140 Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with ADAM10.

By similarity

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
117648, 46 interactors

Protein interaction database and analysis system

More...
IntActi
Q96FV3, 28 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000309036

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q96FV3 protein

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the tetraspanin (TM4SF) family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG3882 Eukaryota
ENOG4111IRY LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000155429

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q96FV3

KEGG Orthology (KO)

More...
KOi
K10303

Database of Orthologous Groups

More...
OrthoDBi
1180379at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q96FV3

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.10.1450.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR000301 Tetraspanin
IPR018499 Tetraspanin/Peripherin
IPR018503 Tetraspanin_CS
IPR008952 Tetraspanin_EC2_sf

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00335 Tetraspanin, 1 hit

PIRSF; a whole-protein classification database

More...
PIRSFi
PIRSF002419 Tetraspanin, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00259 TMFOUR

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF48652 SSF48652, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00421 TM4_1, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 5 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q96FV3-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MPGKHQHFQE PEVGCCGKYF LFGFNIVFWV LGALFLAIGL WAWGEKGVLS
60 70 80 90 100
NISALTDLGG LDPVWLFVVV GGVMSVLGFA GCIGALRENT FLLKFFSVFL
110 120 130 140 150
GLIFFLELAT GILAFVFKDW IRDQLNLFIN NNVKAYRDDI DLQNLIDFAQ
160 170 180 190 200
EYWSCCGARG PNDWNLNIYF NCTDLNPSRE RCGVPFSCCV RDPAEDVLNT
210 220 230 240 250
QCGYDVRLKL ELEQQGFIHT KGCVGQFEKW LQDNLIVVAG VFMGIALLQI
260 270
FGICLAQNLV SDIKAVKANW
Length:270
Mass (Da):30,264
Last modified:May 15, 2007 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i157F76DF059D9E19
GO
Isoform 2 (identifier: Q96FV3-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     260-270: VSDIKAVKANW → EQME

Show »
Length:263
Mass (Da):29,569
Checksum:i820189FB903DDB14
GO
Isoform 3 (identifier: Q96FV3-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     30-95: Missing.
     153-194: Missing.
     249-249: Q → QVPLWPHVPLPLPGPPSLSPHLSSVLQ

Show »
Length:188
Mass (Da):21,415
Checksum:iD68CC9413038D029
GO
Isoform 4 (identifier: Q96FV3-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     270-270: W → WSKWNDDFENHWLTPTISEVLSTAGPQQNSLTGAPGPAPPSRHVFFGLGGLYPEPTFKNW

Show »
Length:329
Mass (Da):36,742
Checksum:i8A7427CFA987ED06
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 5 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
D6RBW9D6RBW9_HUMAN
Tetraspanin
TSPAN17
257Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0Y9A5H0Y9A5_HUMAN
Tetraspanin
TSPAN17
203Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D6RDX8D6RDX8_HUMAN
Tetraspanin
TSPAN17
309Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
J3KNG2J3KNG2_HUMAN
Tetraspanin
TSPAN17
332Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D6RI03D6RI03_HUMAN
Tetraspanin-17
TSPAN17
58Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAF04524 differs from that shown. Reason: Frameshift.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti239A → P in AAK67627 (Ref. 1) Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_057278140I → T. Corresponds to variant dbSNP:rs17624798Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_01138830 – 95Missing in isoform 3. 1 PublicationAdd BLAST66
Alternative sequenceiVSP_011389153 – 194Missing in isoform 3. 1 PublicationAdd BLAST42
Alternative sequenceiVSP_011390249Q → QVPLWPHVPLPLPGPPSLSP HLSSVLQ in isoform 3. 1 Publication1
Alternative sequenceiVSP_011391260 – 270VSDIKAVKANW → EQME in isoform 2. 1 PublicationAdd BLAST11
Alternative sequenceiVSP_025608270W → WSKWNDDFENHWLTPTISEV LSTAGPQQNSLTGAPGPAPP SRHVFFGLGGLYPEPTFKNW in isoform 4. 1 Publication1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AY037146 mRNA Translation: AAK67627.1
AC091934 Genomic DNA No translation available.
BC010405 mRNA Translation: AAH10405.1
BC067105 mRNA Translation: AAH67105.1
AF174603 mRNA Translation: AAF04524.1 Frameshift.

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS47346.2 [Q96FV3-3]
CCDS54952.1 [Q96FV3-4]

NCBI Reference Sequences

More...
RefSeqi
NP_001006617.2, NM_001006616.2 [Q96FV3-3]
NP_569732.2, NM_130465.4 [Q96FV3-4]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000298564; ENSP00000298564; ENSG00000048140 [Q96FV3-2]
ENST00000508164; ENSP00000422053; ENSG00000048140 [Q96FV3-4]
ENST00000515708; ENSP00000426650; ENSG00000048140 [Q96FV3-3]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
26262

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:26262

UCSC genome browser

More...
UCSCi
uc003mes.4 human [Q96FV3-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY037146 mRNA Translation: AAK67627.1
AC091934 Genomic DNA No translation available.
BC010405 mRNA Translation: AAH10405.1
BC067105 mRNA Translation: AAH67105.1
AF174603 mRNA Translation: AAF04524.1 Frameshift.
CCDSiCCDS47346.2 [Q96FV3-3]
CCDS54952.1 [Q96FV3-4]
RefSeqiNP_001006617.2, NM_001006616.2 [Q96FV3-3]
NP_569732.2, NM_130465.4 [Q96FV3-4]

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

BioGridi117648, 46 interactors
IntActiQ96FV3, 28 interactors
STRINGi9606.ENSP00000309036

PTM databases

iPTMnetiQ96FV3

Polymorphism and mutation databases

BioMutaiTSPAN17
DMDMi147744595

Proteomic databases

MassIVEiQ96FV3
PaxDbiQ96FV3
PeptideAtlasiQ96FV3
PRIDEiQ96FV3
ProteomicsDBi76560 [Q96FV3-1]
76561 [Q96FV3-2]
76562 [Q96FV3-3]
76563 [Q96FV3-4]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
29134 92 antibodies

The DNASU plasmid repository

More...
DNASUi
26262

Genome annotation databases

EnsembliENST00000298564; ENSP00000298564; ENSG00000048140 [Q96FV3-2]
ENST00000508164; ENSP00000422053; ENSG00000048140 [Q96FV3-4]
ENST00000515708; ENSP00000426650; ENSG00000048140 [Q96FV3-3]
GeneIDi26262
KEGGihsa:26262
UCSCiuc003mes.4 human [Q96FV3-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
26262

GeneCards: human genes, protein and diseases

More...
GeneCardsi
TSPAN17
HGNCiHGNC:13594 TSPAN17
HPAiENSG00000048140 Low tissue specificity
neXtProtiNX_Q96FV3
OpenTargetsiENSG00000048140
PharmGKBiPA128394740

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG3882 Eukaryota
ENOG4111IRY LUCA
GeneTreeiENSGT00940000155429
InParanoidiQ96FV3
KOiK10303
OrthoDBi1180379at2759
PhylomeDBiQ96FV3

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
TSPAN17 human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
26262
PharosiQ96FV3 Tdark

Protein Ontology

More...
PROi
PR:Q96FV3
RNActiQ96FV3 protein

Gene expression databases

BgeeiENSG00000048140 Expressed in prostate gland and 193 other tissues
ExpressionAtlasiQ96FV3 baseline and differential
GenevisibleiQ96FV3 HS

Family and domain databases

Gene3Di1.10.1450.10, 1 hit
InterProiView protein in InterPro
IPR000301 Tetraspanin
IPR018499 Tetraspanin/Peripherin
IPR018503 Tetraspanin_CS
IPR008952 Tetraspanin_EC2_sf
PfamiView protein in Pfam
PF00335 Tetraspanin, 1 hit
PIRSFiPIRSF002419 Tetraspanin, 1 hit
PRINTSiPR00259 TMFOUR
SUPFAMiSSF48652 SSF48652, 1 hit
PROSITEiView protein in PROSITE
PS00421 TM4_1, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiTSN17_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q96FV3
Secondary accession number(s): Q6NXF7, Q96S98, Q9UKB9
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: August 16, 2004
Last sequence update: May 15, 2007
Last modified: April 22, 2020
This is version 145 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. Human chromosome 5
    Human chromosome 5: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again