Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Secernin-2

Gene

SCRN2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Active sitei12Sequence analysis1

GO - Molecular functioni

GO - Biological processi

Protein family/group databases

MEROPSiC69.004

Names & Taxonomyi

Protein namesi
Recommended name:
Secernin-2
Gene namesi
Name:SCRN2
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 17

Organism-specific databases

EuPathDBiHostDB:ENSG00000141295.13
HGNCiHGNC:30381 SCRN2
MIMi614966 gene
neXtProtiNX_Q96FV2

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Pathology & Biotechi

Organism-specific databases

DisGeNETi90507
OpenTargetsiENSG00000141295
PharmGKBiPA134964266

Polymorphism and mutation databases

BioMutaiSCRN2
DMDMi317373511

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002625521 – 425Secernin-2Add BLAST425

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei52PhosphothreonineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ96FV2
MaxQBiQ96FV2
PaxDbiQ96FV2
PeptideAtlasiQ96FV2
PRIDEiQ96FV2
ProteomicsDBi76559

2D gel databases

REPRODUCTION-2DPAGEiIPI00062266

PTM databases

iPTMnetiQ96FV2
PhosphoSitePlusiQ96FV2

Expressioni

Gene expression databases

BgeeiENSG00000141295
CleanExiHS_SCRN2
ExpressionAtlasiQ96FV2 baseline and differential
GenevisibleiQ96FV2 HS

Organism-specific databases

HPAiHPA022934
HPA023434

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
TINF2Q9BSI42EBI-11306862,EBI-717399

Protein-protein interaction databases

BioGridi124726, 15 interactors
IntActiQ96FV2, 5 interactors
STRINGi9606.ENSP00000290216

Structurei

3D structure databases

ProteinModelPortaliQ96FV2
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Phylogenomic databases

eggNOGiENOG410IGQK Eukaryota
COG4690 LUCA
GeneTreeiENSGT00390000013474
HOGENOMiHOG000223307
HOVERGENiHBG056050
InParanoidiQ96FV2
KOiK14358
PhylomeDBiQ96FV2
TreeFamiTF323890

Family and domain databases

InterProiView protein in InterPro
IPR005322 Peptidase_C69
PANTHERiPTHR12994 PTHR12994, 1 hit
PfamiView protein in Pfam
PF03577 Peptidase_C69, 1 hit

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q96FV2-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MASSSPDSPC SCDCFVSVPP ASAIPAVIFA KNSDRPRDEV QEVVFVPAGT
60 70 80 90 100
HTPGSRLQCT YIEVEQVSKT HAVILSRPSW LWGAEMGANE HGVCIGNEAV
110 120 130 140 150
WTKEPVGEGE ALLGMDLLRL ALERSSSAQE ALHVITGLLE HYGQGGNCLE
160 170 180 190 200
DAAPFSYHST FLLADRTEAW VLETAGRLWA AQRIQEGARN ISNQLSIGTD
210 220 230 240 250
ISAQHPELRT HAQAKGWWDG QGAFDFAQIF SLTQQPVRME AAKARFQAGR
260 270 280 290 300
ELLRQRQGGI TAEVMMGILR DKESGICMDS GGFRTTASMV SVLPQDPTQP
310 320 330 340 350
CVHFLTATPD PSRSVFKPFI FGMGVAQAPQ VLSPTFGAQD PVRTLPRFQT
360 370 380 390 400
QVDRRHTLYR GHQAALGLME RDQDRGQQLQ QKQQDLEQEG LEATQGLLAG
410 420
EWAPPLWELG SLFQAFVKRE SQAYA
Length:425
Mass (Da):46,597
Last modified:January 11, 2011 - v3
Checksum:iAA7A0290D920B359
GO
Isoform 2 (identifier: Q96FV2-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     374-425: DRGQQLQQKQQDLEQEGLEATQGLLAGEWAPPLWELGSLFQAFVKRESQAYA → VSPRE

Show »
Length:378
Mass (Da):41,295
Checksum:iC9FDD7516BCB0BF3
GO

Sequence cautioni

The sequence AAH10408 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_029509103K → R1 PublicationCorresponds to variant dbSNP:rs17856536Ensembl.1
Natural variantiVAR_035263273E → Q. Corresponds to variant dbSNP:rs35901087Ensembl.1
Natural variantiVAR_029510323M → V3 PublicationsCorresponds to variant dbSNP:rs7350974Ensembl.1
Natural variantiVAR_035264330Q → R. Corresponds to variant dbSNP:rs34480825Ensembl.1
Natural variantiVAR_029511411S → G1 PublicationCorresponds to variant dbSNP:rs17856535Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_044566374 – 425DRGQQ…SQAYA → VSPRE in isoform 2. 2 PublicationsAdd BLAST52

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK290646 mRNA Translation: BAF83335.1
AK303835 mRNA Translation: BAH14063.1
AC003665 Genomic DNA No translation available.
CH471109 Genomic DNA Translation: EAW94791.1
CH471109 Genomic DNA Translation: EAW94792.1
BC002980 mRNA Translation: AAH02980.1
BC010408 mRNA Translation: AAH10408.2 Different initiation.
BC017317 mRNA Translation: AAH17317.1
CCDSiCCDS11519.1 [Q96FV2-1]
CCDS45723.1 [Q96FV2-2]
RefSeqiNP_001138495.1, NM_001145023.1 [Q96FV2-2]
NP_612364.2, NM_138355.3 [Q96FV2-1]
XP_005257833.1, XM_005257776.4 [Q96FV2-1]
UniGeneiHs.239718

Genome annotation databases

EnsembliENST00000290216; ENSP00000290216; ENSG00000141295 [Q96FV2-1]
ENST00000407215; ENSP00000383935; ENSG00000141295 [Q96FV2-2]
GeneIDi90507
KEGGihsa:90507
UCSCiuc002imd.4 human [Q96FV2-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiSCRN2_HUMAN
AccessioniPrimary (citable) accession number: Q96FV2
Secondary accession number(s): A8K3N1
, B7Z8S7, E9PBV5, Q96AC3, Q9BU04
Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 28, 2006
Last sequence update: January 11, 2011
Last modified: July 18, 2018
This is version 116 of the entry and version 3 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 17
    Human chromosome 17: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. Peptidase families
    Classification of peptidase families and list of entries
  6. SIMILARITY comments
    Index of protein domains and families

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health