Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 121 (31 Jul 2019)
Sequence version 3 (11 Jan 2011)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Secernin-2

Gene

SCRN2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei12Sequence analysis1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

  • exocytosis Source: GO_Central

Protein family/group databases

MEROPS protease database

More...
MEROPSi
C69.004

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Secernin-2
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:SCRN2
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 17

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:30381 SCRN2

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
614966 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q96FV2

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
90507

Open Targets

More...
OpenTargetsi
ENSG00000141295

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA134964266

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
SCRN2

Domain mapping of disease mutations (DMDM)

More...
DMDMi
317373511

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002625521 – 425Secernin-2Add BLAST425

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei52PhosphothreonineCombined sources1

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q96FV2

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q96FV2

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q96FV2

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q96FV2

PeptideAtlas

More...
PeptideAtlasi
Q96FV2

PRoteomics IDEntifications database

More...
PRIDEi
Q96FV2

ProteomicsDB human proteome resource

More...
ProteomicsDBi
19303
76559 [Q96FV2-1]

2D gel databases

REPRODUCTION-2DPAGE

More...
REPRODUCTION-2DPAGEi
IPI00062266

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q96FV2

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q96FV2

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000141295 Expressed in 186 organ(s), highest expression level in adult mammalian kidney

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q96FV2 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q96FV2 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA022934
HPA023434

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

WithEntry#Exp.IntActNotes
TINF2Q9BSI42EBI-11306862,EBI-717399

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
124726, 15 interactors

Protein interaction database and analysis system

More...
IntActi
Q96FV2, 5 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000290216

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IGQK Eukaryota
COG4690 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000013474

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000223307

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q96FV2

KEGG Orthology (KO)

More...
KOi
K14358

Database of Orthologous Groups

More...
OrthoDBi
322959at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q96FV2

TreeFam database of animal gene trees

More...
TreeFami
TF323890

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR005322 Peptidase_C69

The PANTHER Classification System

More...
PANTHERi
PTHR12994 PTHR12994, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF03577 Peptidase_C69, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 6 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q96FV2-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MASSSPDSPC SCDCFVSVPP ASAIPAVIFA KNSDRPRDEV QEVVFVPAGT
60 70 80 90 100
HTPGSRLQCT YIEVEQVSKT HAVILSRPSW LWGAEMGANE HGVCIGNEAV
110 120 130 140 150
WTKEPVGEGE ALLGMDLLRL ALERSSSAQE ALHVITGLLE HYGQGGNCLE
160 170 180 190 200
DAAPFSYHST FLLADRTEAW VLETAGRLWA AQRIQEGARN ISNQLSIGTD
210 220 230 240 250
ISAQHPELRT HAQAKGWWDG QGAFDFAQIF SLTQQPVRME AAKARFQAGR
260 270 280 290 300
ELLRQRQGGI TAEVMMGILR DKESGICMDS GGFRTTASMV SVLPQDPTQP
310 320 330 340 350
CVHFLTATPD PSRSVFKPFI FGMGVAQAPQ VLSPTFGAQD PVRTLPRFQT
360 370 380 390 400
QVDRRHTLYR GHQAALGLME RDQDRGQQLQ QKQQDLEQEG LEATQGLLAG
410 420
EWAPPLWELG SLFQAFVKRE SQAYA
Length:425
Mass (Da):46,597
Last modified:January 11, 2011 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iAA7A0290D920B359
GO
Isoform 2 (identifier: Q96FV2-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     374-425: DRGQQLQQKQQDLEQEGLEATQGLLAGEWAPPLWELGSLFQAFVKRESQAYA → VSPRE

Show »
Length:378
Mass (Da):41,295
Checksum:iC9FDD7516BCB0BF3
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 6 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
J3QL71J3QL71_HUMAN
Secernin-2
SCRN2
433Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
J3QQM9J3QQM9_HUMAN
Secernin-2
SCRN2
269Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
J3QRJ1J3QRJ1_HUMAN
Secernin-2
SCRN2
271Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
J3QR84J3QR84_HUMAN
Secernin-2
SCRN2
180Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
J3KT79J3KT79_HUMAN
Secernin-2
SCRN2
127Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
J3KS57J3KS57_HUMAN
Secernin-2
SCRN2
97Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAH10408 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_029509103K → R1 PublicationCorresponds to variant dbSNP:rs17856536Ensembl.1
Natural variantiVAR_035263273E → Q. Corresponds to variant dbSNP:rs35901087Ensembl.1
Natural variantiVAR_029510323M → V3 PublicationsCorresponds to variant dbSNP:rs7350974Ensembl.1
Natural variantiVAR_035264330Q → R. Corresponds to variant dbSNP:rs34480825Ensembl.1
Natural variantiVAR_029511411S → G1 PublicationCorresponds to variant dbSNP:rs17856535Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_044566374 – 425DRGQQ…SQAYA → VSPRE in isoform 2. 2 PublicationsAdd BLAST52

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AK290646 mRNA Translation: BAF83335.1
AK303835 mRNA Translation: BAH14063.1
AC003665 Genomic DNA No translation available.
CH471109 Genomic DNA Translation: EAW94791.1
CH471109 Genomic DNA Translation: EAW94792.1
BC002980 mRNA Translation: AAH02980.1
BC010408 mRNA Translation: AAH10408.2 Different initiation.
BC017317 mRNA Translation: AAH17317.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS11519.1 [Q96FV2-1]
CCDS45723.1 [Q96FV2-2]

NCBI Reference Sequences

More...
RefSeqi
NP_001138495.1, NM_001145023.1 [Q96FV2-2]
NP_612364.2, NM_138355.3 [Q96FV2-1]
XP_005257833.1, XM_005257776.4 [Q96FV2-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000290216; ENSP00000290216; ENSG00000141295 [Q96FV2-1]
ENST00000407215; ENSP00000383935; ENSG00000141295 [Q96FV2-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
90507

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:90507

UCSC genome browser

More...
UCSCi
uc002imd.4 human [Q96FV2-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK290646 mRNA Translation: BAF83335.1
AK303835 mRNA Translation: BAH14063.1
AC003665 Genomic DNA No translation available.
CH471109 Genomic DNA Translation: EAW94791.1
CH471109 Genomic DNA Translation: EAW94792.1
BC002980 mRNA Translation: AAH02980.1
BC010408 mRNA Translation: AAH10408.2 Different initiation.
BC017317 mRNA Translation: AAH17317.1
CCDSiCCDS11519.1 [Q96FV2-1]
CCDS45723.1 [Q96FV2-2]
RefSeqiNP_001138495.1, NM_001145023.1 [Q96FV2-2]
NP_612364.2, NM_138355.3 [Q96FV2-1]
XP_005257833.1, XM_005257776.4 [Q96FV2-1]

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

BioGridi124726, 15 interactors
IntActiQ96FV2, 5 interactors
STRINGi9606.ENSP00000290216

Protein family/group databases

MEROPSiC69.004

PTM databases

iPTMnetiQ96FV2
PhosphoSitePlusiQ96FV2

Polymorphism and mutation databases

BioMutaiSCRN2
DMDMi317373511

2D gel databases

REPRODUCTION-2DPAGEiIPI00062266

Proteomic databases

EPDiQ96FV2
jPOSTiQ96FV2
MaxQBiQ96FV2
PaxDbiQ96FV2
PeptideAtlasiQ96FV2
PRIDEiQ96FV2
ProteomicsDBi19303
76559 [Q96FV2-1]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
90507
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000290216; ENSP00000290216; ENSG00000141295 [Q96FV2-1]
ENST00000407215; ENSP00000383935; ENSG00000141295 [Q96FV2-2]
GeneIDi90507
KEGGihsa:90507
UCSCiuc002imd.4 human [Q96FV2-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
90507
DisGeNETi90507

GeneCards: human genes, protein and diseases

More...
GeneCardsi
SCRN2
HGNCiHGNC:30381 SCRN2
HPAiHPA022934
HPA023434
MIMi614966 gene
neXtProtiNX_Q96FV2
OpenTargetsiENSG00000141295
PharmGKBiPA134964266

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410IGQK Eukaryota
COG4690 LUCA
GeneTreeiENSGT00390000013474
HOGENOMiHOG000223307
InParanoidiQ96FV2
KOiK14358
OrthoDBi322959at2759
PhylomeDBiQ96FV2
TreeFamiTF323890

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
SCRN2 human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
90507

Protein Ontology

More...
PROi
PR:Q96FV2

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000141295 Expressed in 186 organ(s), highest expression level in adult mammalian kidney
ExpressionAtlasiQ96FV2 baseline and differential
GenevisibleiQ96FV2 HS

Family and domain databases

InterProiView protein in InterPro
IPR005322 Peptidase_C69
PANTHERiPTHR12994 PTHR12994, 1 hit
PfamiView protein in Pfam
PF03577 Peptidase_C69, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiSCRN2_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q96FV2
Secondary accession number(s): A8K3N1
, B7Z8S7, E9PBV5, Q96AC3, Q9BU04
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 28, 2006
Last sequence update: January 11, 2011
Last modified: July 31, 2019
This is version 121 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. Human chromosome 17
    Human chromosome 17: entries, gene names and cross-references to MIM
  6. Peptidase families
    Classification of peptidase families and list of entries
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again