Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

AMSH-like protease

Gene

STAMBPL1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Zinc metalloprotease that specifically cleaves 'Lys-63'-linked polyubiquitin chains. Does not cleave 'Lys-48'-linked polyubiquitin chains.1 Publication

Cofactori

Zn2+1 PublicationNote: Binds 2 Zn2+ ions per subunit.1 Publication

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sitei292Indirect zinc-binding1
Metal bindingi347Zinc 1; catalyticPROSITE-ProRule annotation1
Metal bindingi349Zinc 1; catalyticPROSITE-ProRule annotation1
Metal bindingi360Zinc 1; catalyticPROSITE-ProRule annotation1
Metal bindingi362Zinc 21
Metal bindingi402Zinc 21
Metal bindingi408Zinc 21
Metal bindingi410Zinc 21

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionHydrolase, Metalloprotease, Protease
Biological processUbl conjugation pathway
LigandMetal-binding, Zinc

Enzyme and pathway databases

ReactomeiR-HSA-5689901 Metalloprotease DUBs

Protein family/group databases

MEROPSiM67.003

Names & Taxonomyi

Protein namesi
Recommended name:
AMSH-like protease (EC:3.4.19.-)
Short name:
AMSH-LP
Alternative name(s):
STAM-binding protein-like 1
Gene namesi
Name:STAMBPL1
Synonyms:AMSHLP, KIAA1373
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 10

Organism-specific databases

EuPathDBiHostDB:ENSG00000138134.11
HGNCiHGNC:24105 STAMBPL1
MIMi612352 gene
neXtProtiNX_Q96FJ0

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi292E → A: Complete loss of catalytic activity. 1 Publication1
Mutagenesisi329E → A: 3-fold decrease in substrate affinity. 1 Publication1
Mutagenesisi332F → A: 12-fold decrease in substrate affinity, little effect on catalytic activity. 1 Publication1
Mutagenesisi353T → A: 19-fold decrease in activity, no change in substrate affinity. 1 Publication1
Mutagenesisi355F → A: 161-fold decrease in activity, no change in substrate affinity. 1 Publication1
Mutagenesisi357S → A: 34-fold decrease in activity. 1 Publication1
Mutagenesisi358S → A: 10-fold decrease in activity, no change in substrate affinity. 1 Publication1
Mutagenesisi360D → A: Complete loss of catalytic activity. 1 Publication1
Mutagenesisi370M → A: 18-fold decrease in substrate affinity, little effect on catalytic activity. 1 Publication1
Mutagenesisi402C → S: 402-fold decrease in activity, slight increase in substrate affinity. 1 Publication1
Mutagenesisi407F → A: 35-fold decrease in activity, slight increase in substrate affinity. 1 Publication1

Organism-specific databases

DisGeNETi57559
OpenTargetsiENSG00000138134
PharmGKBiPA142670864

Polymorphism and mutation databases

BioMutaiSTAMBPL1
DMDMi71153542

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001948741 – 436AMSH-like proteaseAdd BLAST436

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei1N-acetylmethionineCombined sources1
Modified residuei25PhosphoserineCombined sources1
Modified residuei242PhosphoserineCombined sources1

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

EPDiQ96FJ0
MaxQBiQ96FJ0
PaxDbiQ96FJ0
PeptideAtlasiQ96FJ0
PRIDEiQ96FJ0
ProteomicsDBi76533
76534 [Q96FJ0-2]

PTM databases

iPTMnetiQ96FJ0
PhosphoSitePlusiQ96FJ0

Expressioni

Tissue specificityi

Ubiquitously expressed.1 Publication

Gene expression databases

BgeeiENSG00000138134 Expressed in 199 organ(s), highest expression level in testis
CleanExiHS_STAMBPL1
ExpressionAtlasiQ96FJ0 baseline and differential
GenevisibleiQ96FJ0 HS

Organism-specific databases

HPAiHPA040202

Interactioni

Binary interactionsi

Protein-protein interaction databases

BioGridi121614, 50 interactors
IntActiQ96FJ0, 39 interactors
MINTiQ96FJ0
STRINGi9606.ENSP00000360992

Structurei

Secondary structure

1436
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

ProteinModelPortaliQ96FJ0
SMRiQ96FJ0
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ96FJ0

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini269 – 397MPNPROSITE-ProRule annotationAdd BLAST129

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Motifi347 – 360JAMM motifPROSITE-ProRule annotationAdd BLAST14

Domaini

The JAMM motif is essential for the protease activity.By similarity

Sequence similaritiesi

Belongs to the peptidase M67C family.Curated

Phylogenomic databases

eggNOGiKOG2880 Eukaryota
COG1310 LUCA
GeneTreeiENSGT00930000150927
HOGENOMiHOG000195792
HOVERGENiHBG058519
InParanoidiQ96FJ0
KOiK11867
OMAiCHKFLLL
OrthoDBiEOG091G06CJ
PhylomeDBiQ96FJ0
TreeFamiTF323215

Family and domain databases

InterProiView protein in InterPro
IPR000555 JAMM/MPN+_dom
IPR037518 MPN
IPR015063 USP8_dimer
PfamiView protein in Pfam
PF01398 JAB, 1 hit
PF08969 USP8_dimer, 1 hit
SMARTiView protein in SMART
SM00232 JAB_MPN, 1 hit
PROSITEiView protein in PROSITE
PS50249 MPN, 1 hit

Sequences (2+)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q96FJ0-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MDQPFTVNSL KKLAAMPDHT DVSLSPEERV RALSKLGCNI TISEDITPRR
60 70 80 90 100
YFRSGVEMER MASVYLEEGN LENAFVLYNK FITLFVEKLP NHRDYQQCAV
110 120 130 140 150
PEKQDIMKKL KEIAFPRTDE LKNDLLKKYN VEYQEYLQSK NKYKAEILKK
160 170 180 190 200
LEHQRLIEAE RKRIAQMRQQ QLESEQFLFF EDQLKKQELA RGQMRSQQTS
210 220 230 240 250
GLSEQIDGSA LSCFSTHQNN SLLNVFADQP NKSDATNYAS HSPPVNRALT
260 270 280 290 300
PAATLSAVQN LVVEGLRCVV LPEDLCHKFL QLAESNTVRG IETCGILCGK
310 320 330 340 350
LTHNEFTITH VIVPKQSAGP DYCDMENVEE LFNVQDQHDL LTLGWIHTHP
360 370 380 390 400
TQTAFLSSVD LHTHCSYQLM LPEAIAIVCS PKHKDTGIFR LTNAGMLEVS
410 420 430
ACKKKGFHPH TKEPRLFSIC KHVLVKDIKI IVLDLR
Length:436
Mass (Da):49,783
Last modified:November 23, 2004 - v2
Checksum:i722662C76A734102
GO
Isoform 2 (identifier: Q96FJ0-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     420-436: CKHVLVKDIKIIVLDLR → QKFLSGIISGTALEMEPLKIGYGPNGFPLLGISRSSSPSEQL

Show »
Length:461
Mass (Da):52,199
Checksum:i266828EB12055970
GO

Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
B3KR00B3KR00_HUMAN
AMSH-like protease
STAMBPL1
270Annotation score:

Sequence cautioni

The sequence BAA92611 differs from that shown. Reason: Erroneous initiation.Curated

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_051817196S → N. Corresponds to variant dbSNP:rs12254856Ensembl.1
Natural variantiVAR_051818204E → K. Corresponds to variant dbSNP:rs34270879Ensembl.1
Natural variantiVAR_051819210A → T. Corresponds to variant dbSNP:rs9988723Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_014648420 – 436CKHVL…VLDLR → QKFLSGIISGTALEMEPLKI GYGPNGFPLLGISRSSSPSE QL in isoform 2. 1 PublicationAdd BLAST17

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB010120 mRNA Translation: BAC77766.1
AB037794 mRNA Translation: BAA92611.1 Different initiation.
AK056086 mRNA Translation: BAG51619.1
AL157394 Genomic DNA No translation available.
CH471066 Genomic DNA Translation: EAW50156.1
BC010846 mRNA Translation: AAH10846.2
CCDSiCCDS7391.1 [Q96FJ0-1]
RefSeqiNP_065850.1, NM_020799.3 [Q96FJ0-1]
XP_006717991.1, XM_006717928.2 [Q96FJ0-1]
XP_006717993.1, XM_006717930.3 [Q96FJ0-1]
XP_011538285.1, XM_011539983.1 [Q96FJ0-1]
XP_011538287.1, XM_011539985.1 [Q96FJ0-1]
XP_016871942.1, XM_017016453.1 [Q96FJ0-1]
XP_016871943.1, XM_017016454.1
XP_016871944.1, XM_017016455.1 [Q96FJ0-1]
XP_016871945.1, XM_017016456.1 [Q96FJ0-1]
UniGeneiHs.16229
Hs.701879

Genome annotation databases

EnsembliENST00000371924; ENSP00000360992; ENSG00000138134 [Q96FJ0-1]
ENST00000371926; ENSP00000360994; ENSG00000138134 [Q96FJ0-1]
ENST00000371927; ENSP00000360995; ENSG00000138134 [Q96FJ0-2]
GeneIDi57559
KEGGihsa:57559
UCSCiuc001kfk.5 human [Q96FJ0-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB010120 mRNA Translation: BAC77766.1
AB037794 mRNA Translation: BAA92611.1 Different initiation.
AK056086 mRNA Translation: BAG51619.1
AL157394 Genomic DNA No translation available.
CH471066 Genomic DNA Translation: EAW50156.1
BC010846 mRNA Translation: AAH10846.2
CCDSiCCDS7391.1 [Q96FJ0-1]
RefSeqiNP_065850.1, NM_020799.3 [Q96FJ0-1]
XP_006717991.1, XM_006717928.2 [Q96FJ0-1]
XP_006717993.1, XM_006717930.3 [Q96FJ0-1]
XP_011538285.1, XM_011539983.1 [Q96FJ0-1]
XP_011538287.1, XM_011539985.1 [Q96FJ0-1]
XP_016871942.1, XM_017016453.1 [Q96FJ0-1]
XP_016871943.1, XM_017016454.1
XP_016871944.1, XM_017016455.1 [Q96FJ0-1]
XP_016871945.1, XM_017016456.1 [Q96FJ0-1]
UniGeneiHs.16229
Hs.701879

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2ZNRX-ray1.20A264-436[»]
2ZNVX-ray1.60A/D264-436[»]
ProteinModelPortaliQ96FJ0
SMRiQ96FJ0
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi121614, 50 interactors
IntActiQ96FJ0, 39 interactors
MINTiQ96FJ0
STRINGi9606.ENSP00000360992

Protein family/group databases

MEROPSiM67.003

PTM databases

iPTMnetiQ96FJ0
PhosphoSitePlusiQ96FJ0

Polymorphism and mutation databases

BioMutaiSTAMBPL1
DMDMi71153542

Proteomic databases

EPDiQ96FJ0
MaxQBiQ96FJ0
PaxDbiQ96FJ0
PeptideAtlasiQ96FJ0
PRIDEiQ96FJ0
ProteomicsDBi76533
76534 [Q96FJ0-2]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000371924; ENSP00000360992; ENSG00000138134 [Q96FJ0-1]
ENST00000371926; ENSP00000360994; ENSG00000138134 [Q96FJ0-1]
ENST00000371927; ENSP00000360995; ENSG00000138134 [Q96FJ0-2]
GeneIDi57559
KEGGihsa:57559
UCSCiuc001kfk.5 human [Q96FJ0-1]

Organism-specific databases

CTDi57559
DisGeNETi57559
EuPathDBiHostDB:ENSG00000138134.11
GeneCardsiSTAMBPL1
H-InvDBiHIX0009014
HGNCiHGNC:24105 STAMBPL1
HPAiHPA040202
MIMi612352 gene
neXtProtiNX_Q96FJ0
OpenTargetsiENSG00000138134
PharmGKBiPA142670864
HUGEiSearch...
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG2880 Eukaryota
COG1310 LUCA
GeneTreeiENSGT00930000150927
HOGENOMiHOG000195792
HOVERGENiHBG058519
InParanoidiQ96FJ0
KOiK11867
OMAiCHKFLLL
OrthoDBiEOG091G06CJ
PhylomeDBiQ96FJ0
TreeFamiTF323215

Enzyme and pathway databases

ReactomeiR-HSA-5689901 Metalloprotease DUBs

Miscellaneous databases

ChiTaRSiSTAMBPL1 human
EvolutionaryTraceiQ96FJ0
GeneWikiiSTAMBPL1
GenomeRNAii57559
PROiPR:Q96FJ0
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000138134 Expressed in 199 organ(s), highest expression level in testis
CleanExiHS_STAMBPL1
ExpressionAtlasiQ96FJ0 baseline and differential
GenevisibleiQ96FJ0 HS

Family and domain databases

InterProiView protein in InterPro
IPR000555 JAMM/MPN+_dom
IPR037518 MPN
IPR015063 USP8_dimer
PfamiView protein in Pfam
PF01398 JAB, 1 hit
PF08969 USP8_dimer, 1 hit
SMARTiView protein in SMART
SM00232 JAB_MPN, 1 hit
PROSITEiView protein in PROSITE
PS50249 MPN, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiSTALP_HUMAN
AccessioniPrimary (citable) accession number: Q96FJ0
Secondary accession number(s): B3KPA7
, Q5T9N4, Q5T9N9, Q7Z420, Q9P2H4
Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 19, 2005
Last sequence update: November 23, 2004
Last modified: November 7, 2018
This is version 138 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Peptidase families
    Classification of peptidase families and list of entries
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  6. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  7. Human chromosome 10
    Human chromosome 10: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again