Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Phytanoyl-CoA hydroxylase-interacting protein-like

Gene

PHYHIPL

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

May play a role in the development of the central system.By similarity

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Phytanoyl-CoA hydroxylase-interacting protein-like
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:PHYHIPL
Synonyms:KIAA1796
ORF Names:UNQ6309/PRO20934
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 10

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000165443.11

Human Gene Nomenclature Database

More...
HGNCi
HGNC:29378 PHYHIPL

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q96FC7

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
84457

Open Targets

More...
OpenTargetsi
ENSG00000165443

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA134906827

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
PHYHIPL

Domain mapping of disease mutations (DMDM)

More...
DMDMi
296439274

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003386411 – 376Phytanoyl-CoA hydroxylase-interacting protein-likeAdd BLAST376

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei12PhosphoserineBy similarity1
Modified residuei15PhosphoserineBy similarity1
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi23N-linked (GlcNAc...) asparagineSequence analysis1
Modified residuei25PhosphoserineBy similarity1
Glycosylationi37N-linked (GlcNAc...) asparagineSequence analysis1

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - PTMi

Glycoprotein, Phosphoprotein

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q96FC7

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q96FC7

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q96FC7

PeptideAtlas

More...
PeptideAtlasi
Q96FC7

PRoteomics IDEntifications database

More...
PRIDEi
Q96FC7

ProteomicsDB human proteome resource

More...
ProteomicsDBi
76508
76509 [Q96FC7-2]
76510 [Q96FC7-3]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q96FC7

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q96FC7

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000165443 Expressed in 138 organ(s), highest expression level in substantia nigra

CleanEx database of gene expression profiles

More...
CleanExi
HS_PHYHIPL

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q96FC7 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA038746

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

WithEntry#Exp.IntActNotes
PDE9AO760833EBI-10285660,EBI-742764

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
124092, 15 interactors

Protein interaction database and analysis system

More...
IntActi
Q96FC7, 18 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000362987

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q96FC7

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini52 – 161Fibronectin type-IIIPROSITE-ProRule annotationAdd BLAST110

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the PHYHIP family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IEM3 Eukaryota
ENOG410Y0U7 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000014563

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG053596

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q96FC7

Identification of Orthologs from Complete Genome Data

More...
OMAi
PCEGMIK

Database of Orthologous Groups

More...
OrthoDBi
659430at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q96FC7

TreeFam database of animal gene trees

More...
TreeFami
TF314485

Family and domain databases

Conserved Domains Database

More...
CDDi
cd00063 FN3, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
2.60.40.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR003961 FN3_dom
IPR036116 FN3_sf
IPR013783 Ig-like_fold

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00041 fn3, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF49265 SSF49265, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50853 FN3, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q96FC7-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MEVPRLDHAL NSPTSPCEEV IKNLSLEAIQ LCDRDGNKSQ DSGIAEMEEL
60 70 80 90 100
PVPHNIKISN ITCDSFKISW EMDSKSKDRI THYFIDLNKK ENKNSNKFKH
110 120 130 140 150
KDVPTKLVAK AVPLPMTVRG HWFLSPRTEY TVAVQTASKQ VDGDYVVSEW
160 170 180 190 200
SEIIEFCTAD YSKVHLTQLL EKAEVIAGRM LKFSVFYRNQ HKEYFDYVRE
210 220 230 240 250
HHGNAMQPSV KDNSGSHGSP ISGKLEGIFF SCSTEFNTGK PPQDSPYGRY
260 270 280 290 300
RFEIAAEKLF NPNTNLYFGD FYCMYTAYHY VILVIAPVGS PGDEFCKQRL
310 320 330 340 350
PQLNSKDNKF LTCTEEDGVL VYHHAQDVIL EVIYTDPVDL SVGTVAEITG
360 370
HQLMSLSTAN AKKDPSCKTC NISVGR
Length:376
Mass (Da):42,486
Last modified:May 18, 2010 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i82B811267DFF088C
GO
Isoform 2 (identifier: Q96FC7-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-36: MEVPRLDHALNSPTSPCEEVIKNLSLEAIQLCDRDG → MCCDSDFVAR

Show »
Length:350
Mass (Da):39,638
Checksum:i8ED6065B4AB4CDE8
GO
Isoform 3 (identifier: Q96FC7-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     36-49: GNKSQDSGIAEMEE → VVFEELTSKQTRKG
     50-376: Missing.

Show »
Length:49
Mass (Da):5,541
Checksum:iF45A14AF238B8B05
GO

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAQ88529 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence CAB97028 differs from that shown. Reason: Frameshift at position 350.Curated

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_043817342V → L7 PublicationsCorresponds to variant dbSNP:rs2452505Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0340671 – 36MEVPR…CDRDG → MCCDSDFVAR in isoform 2. 1 PublicationAdd BLAST36
Alternative sequenceiVSP_03406836 – 49GNKSQ…AEMEE → VVFEELTSKQTRKG in isoform 3. 1 PublicationAdd BLAST14
Alternative sequenceiVSP_03406950 – 376Missing in isoform 3. 1 PublicationAdd BLAST327

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AL365474 mRNA Translation: CAB97028.1 Frameshift.
AK054956 mRNA Translation: BAB70832.1
AL834339 mRNA Translation: CAD39006.1
CR749429 mRNA Translation: CAH18267.1
AC016398 Genomic DNA No translation available.
AC025038 Genomic DNA No translation available.
CH471083 Genomic DNA Translation: EAW54185.1
BC011268 mRNA Translation: AAH11268.2
AY358162 mRNA Translation: AAQ88529.1 Different initiation.
AB058699 mRNA Translation: BAB47425.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS44405.1 [Q96FC7-2]
CCDS7254.1 [Q96FC7-1]

NCBI Reference Sequences

More...
RefSeqi
NP_001137246.1, NM_001143774.1 [Q96FC7-2]
NP_115815.2, NM_032439.3 [Q96FC7-1]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.499704

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000373878; ENSP00000362985; ENSG00000165443 [Q96FC7-2]
ENST00000373880; ENSP00000362987; ENSG00000165443 [Q96FC7-1]
ENST00000486074; ENSP00000423634; ENSG00000165443 [Q96FC7-3]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
84457

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:84457

UCSC genome browser

More...
UCSCi
uc001jkk.5 human [Q96FC7-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AL365474 mRNA Translation: CAB97028.1 Frameshift.
AK054956 mRNA Translation: BAB70832.1
AL834339 mRNA Translation: CAD39006.1
CR749429 mRNA Translation: CAH18267.1
AC016398 Genomic DNA No translation available.
AC025038 Genomic DNA No translation available.
CH471083 Genomic DNA Translation: EAW54185.1
BC011268 mRNA Translation: AAH11268.2
AY358162 mRNA Translation: AAQ88529.1 Different initiation.
AB058699 mRNA Translation: BAB47425.1
CCDSiCCDS44405.1 [Q96FC7-2]
CCDS7254.1 [Q96FC7-1]
RefSeqiNP_001137246.1, NM_001143774.1 [Q96FC7-2]
NP_115815.2, NM_032439.3 [Q96FC7-1]
UniGeneiHs.499704

3D structure databases

ProteinModelPortaliQ96FC7
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi124092, 15 interactors
IntActiQ96FC7, 18 interactors
STRINGi9606.ENSP00000362987

PTM databases

iPTMnetiQ96FC7
PhosphoSitePlusiQ96FC7

Polymorphism and mutation databases

BioMutaiPHYHIPL
DMDMi296439274

Proteomic databases

jPOSTiQ96FC7
MaxQBiQ96FC7
PaxDbiQ96FC7
PeptideAtlasiQ96FC7
PRIDEiQ96FC7
ProteomicsDBi76508
76509 [Q96FC7-2]
76510 [Q96FC7-3]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
84457
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000373878; ENSP00000362985; ENSG00000165443 [Q96FC7-2]
ENST00000373880; ENSP00000362987; ENSG00000165443 [Q96FC7-1]
ENST00000486074; ENSP00000423634; ENSG00000165443 [Q96FC7-3]
GeneIDi84457
KEGGihsa:84457
UCSCiuc001jkk.5 human [Q96FC7-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
84457
DisGeNETi84457
EuPathDBiHostDB:ENSG00000165443.11

GeneCards: human genes, protein and diseases

More...
GeneCardsi
PHYHIPL
HGNCiHGNC:29378 PHYHIPL
HPAiHPA038746
neXtProtiNX_Q96FC7
OpenTargetsiENSG00000165443
PharmGKBiPA134906827

Human Unidentified Gene-Encoded large proteins database

More...
HUGEi
Search...

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410IEM3 Eukaryota
ENOG410Y0U7 LUCA
GeneTreeiENSGT00390000014563
HOVERGENiHBG053596
InParanoidiQ96FC7
OMAiPCEGMIK
OrthoDBi659430at2759
PhylomeDBiQ96FC7
TreeFamiTF314485

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
PHYHIPL human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
PHYHIPL

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
84457

Protein Ontology

More...
PROi
PR:Q96FC7

Gene expression databases

BgeeiENSG00000165443 Expressed in 138 organ(s), highest expression level in substantia nigra
CleanExiHS_PHYHIPL
GenevisibleiQ96FC7 HS

Family and domain databases

CDDicd00063 FN3, 1 hit
Gene3Di2.60.40.10, 1 hit
InterProiView protein in InterPro
IPR003961 FN3_dom
IPR036116 FN3_sf
IPR013783 Ig-like_fold
PfamiView protein in Pfam
PF00041 fn3, 1 hit
SUPFAMiSSF49265 SSF49265, 1 hit
PROSITEiView protein in PROSITE
PS50853 FN3, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiPHIPL_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q96FC7
Secondary accession number(s): B7WP61
, Q68DF3, Q6UXY3, Q8N3W3, Q96JM9, Q96NP7
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: June 10, 2008
Last sequence update: May 18, 2010
Last modified: January 16, 2019
This is version 145 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. Human chromosome 10
    Human chromosome 10: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again