Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 136 (02 Jun 2021)
Sequence version 1 (01 Dec 2001)
Previous versions | rss
Add a publicationFeedback
Protein

CB1 cannabinoid receptor-interacting protein 1

Gene

CNRIP1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Suppresses cannabinoid receptor CNR1-mediated tonic inhibition of voltage-gated calcium channels.

1 Publication

Does not suppress cannabinoid receptor CNR1-mediated tonic inhibition of voltage-gated calcium channels.

1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...
PathwayCommonsi
Q96F85

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
CB1 cannabinoid receptor-interacting protein 1
Short name:
CRIP-1
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:CNRIP1
Synonyms:C2orf32
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 2

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:24546, CNRIP1

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
618538, gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q96F85

Eukaryotic Pathogen, Vector and Host Database Resources

More...
VEuPathDBi
HostDB:ENSG00000119865.8

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
25927

Open Targets

More...
OpenTargetsi
ENSG00000119865

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA162382635

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q96F85, Tbio

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
CNRIP1

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000893601 – 164CB1 cannabinoid receptor-interacting protein 1Add BLAST164

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q96F85

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q96F85

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q96F85

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q96F85

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q96F85

PeptideAtlas

More...
PeptideAtlasi
Q96F85

PRoteomics IDEntifications database

More...
PRIDEi
Q96F85

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
76501 [Q96F85-1]
76502 [Q96F85-2]

2D gel databases

University College Dublin 2-DE Proteome Database

More...
UCD-2DPAGEi
Q96F85

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q96F85

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q96F85

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000119865, Expressed in secondary oocyte and 211 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q96F85, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q96F85, HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000119865, Tissue enhanced (brain)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with the cannabinoid receptor CNR1 (via C-terminus). Does not interact with cannabinoid receptor CNR2.

1 Publication

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
117427, 13 interactors

Protein interaction database and analysis system

More...
IntActi
Q96F85, 10 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000263655

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q96F85, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the CNRIP family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG502QTXE, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000004284

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_110298_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q96F85

Identification of Orthologs from Complete Genome Data

More...
OMAi
RQPIQVN

Database of Orthologous Groups

More...
OrthoDBi
1364162at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q96F85

TreeFam database of animal gene trees

More...
TreeFami
TF332485

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR029204, CNRIP1

The PANTHER Classification System

More...
PANTHERi
PTHR31952, PTHR31952, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF15043, CNRIP1, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q96F85-1) [UniParc]FASTAAdd to basket
Also known as: CRIP1a

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MGDLPGLVRL SIALRIQPND GPVFYKVDGQ RFGQNRTIKL LTGSSYKVEV
60 70 80 90 100
KIKPSTLQVE NISIGGVLVP LELKSKEPDG DRVVYTGTYD TEGVTPTKSG
110 120 130 140 150
ERQPIQITMP FTDIGTFETV WQVKFYNYHK RDHCQWGSPF SVIEYECKPN
160
ETRSLMWVNK ESFL
Length:164
Mass (Da):18,648
Last modified:December 1, 2001 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iAB8432C13F44FF04
GO
Isoform 2 (identifier: Q96F85-2) [UniParc]FASTAAdd to basket
Also known as: CRIP1b

The sequence of this isoform differs from the canonical sequence as follows:
     111-164: FTDIGTFETVWQVKFYNYHKRDHCQWGSPFSVIEYECKPNETRSLMWVNKESFL → ECLEQRPQEISLTYECEE

Show »
Length:128
Mass (Da):14,224
Checksum:i7D788CA2C3CC4B32
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
B8ZZB8B8ZZB8_HUMAN
CB1 cannabinoid receptor-interactin...
CNRIP1
137Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti16I → T in CAB53688 (PubMed:17974005).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_035598111 – 164FTDIG…KESFL → ECLEQRPQEISLTYECEE in isoform 2. 1 PublicationAdd BLAST54

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AY144596 mRNA Translation: AAN41658.1
AK311784 mRNA Translation: BAG34727.1
AC015969 Genomic DNA Translation: AAX93120.1
CH471053 Genomic DNA Translation: EAW99877.1
BC011535 mRNA Translation: AAH11535.1
AL110235 mRNA Translation: CAB53688.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS1886.1 [Q96F85-1]
CCDS46311.1 [Q96F85-2]

Protein sequence database of the Protein Information Resource

More...
PIRi
T14768

NCBI Reference Sequences

More...
RefSeqi
NP_001104571.1, NM_001111101.1 [Q96F85-2]
NP_056278.1, NM_015463.2 [Q96F85-1]
XP_005264306.1, XM_005264249.1
XP_006712047.1, XM_006711984.1

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000263655; ENSP00000263655; ENSG00000119865 [Q96F85-1]
ENST00000409559; ENSP00000386883; ENSG00000119865 [Q96F85-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
25927

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:25927

UCSC genome browser

More...
UCSCi
uc002sej.5, human [Q96F85-1]

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY144596 mRNA Translation: AAN41658.1
AK311784 mRNA Translation: BAG34727.1
AC015969 Genomic DNA Translation: AAX93120.1
CH471053 Genomic DNA Translation: EAW99877.1
BC011535 mRNA Translation: AAH11535.1
AL110235 mRNA Translation: CAB53688.1
CCDSiCCDS1886.1 [Q96F85-1]
CCDS46311.1 [Q96F85-2]
PIRiT14768
RefSeqiNP_001104571.1, NM_001111101.1 [Q96F85-2]
NP_056278.1, NM_015463.2 [Q96F85-1]
XP_005264306.1, XM_005264249.1
XP_006712047.1, XM_006711984.1

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

BioGRIDi117427, 13 interactors
IntActiQ96F85, 10 interactors
STRINGi9606.ENSP00000263655

PTM databases

iPTMnetiQ96F85
PhosphoSitePlusiQ96F85

Genetic variation databases

BioMutaiCNRIP1

2D gel databases

UCD-2DPAGEiQ96F85

Proteomic databases

EPDiQ96F85
jPOSTiQ96F85
MassIVEiQ96F85
MaxQBiQ96F85
PaxDbiQ96F85
PeptideAtlasiQ96F85
PRIDEiQ96F85
ProteomicsDBi76501 [Q96F85-1]
76502 [Q96F85-2]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
30920, 88 antibodies

The DNASU plasmid repository

More...
DNASUi
25927

Genome annotation databases

EnsembliENST00000263655; ENSP00000263655; ENSG00000119865 [Q96F85-1]
ENST00000409559; ENSP00000386883; ENSG00000119865 [Q96F85-2]
GeneIDi25927
KEGGihsa:25927
UCSCiuc002sej.5, human [Q96F85-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
25927
DisGeNETi25927

GeneCards: human genes, protein and diseases

More...
GeneCardsi
CNRIP1
HGNCiHGNC:24546, CNRIP1
HPAiENSG00000119865, Tissue enhanced (brain)
MIMi618538, gene
neXtProtiNX_Q96F85
OpenTargetsiENSG00000119865
PharmGKBiPA162382635
VEuPathDBiHostDB:ENSG00000119865.8

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG502QTXE, Eukaryota
GeneTreeiENSGT00390000004284
HOGENOMiCLU_110298_0_0_1
InParanoidiQ96F85
OMAiRQPIQVN
OrthoDBi1364162at2759
PhylomeDBiQ96F85
TreeFamiTF332485

Enzyme and pathway databases

PathwayCommonsiQ96F85

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
25927, 4 hits in 991 CRISPR screens

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
25927
PharosiQ96F85, Tbio

Protein Ontology

More...
PROi
PR:Q96F85
RNActiQ96F85, protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000119865, Expressed in secondary oocyte and 211 other tissues
ExpressionAtlasiQ96F85, baseline and differential
GenevisibleiQ96F85, HS

Family and domain databases

InterProiView protein in InterPro
IPR029204, CNRIP1
PANTHERiPTHR31952, PTHR31952, 1 hit
PfamiView protein in Pfam
PF15043, CNRIP1, 1 hit

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiCNRP1_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q96F85
Secondary accession number(s): B2R4D0, Q49AN4, Q9UFZ0
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 5, 2005
Last sequence update: December 1, 2001
Last modified: June 2, 2021
This is version 136 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again