Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
We will be switching to the new UniProt website soon. Please explore and share your feedback. Take me to the new website.

UniProtKB - Q96F24 (NRBF2_HUMAN)

Entry version 159 (23 Feb 2022)
Sequence version 1 (01 Dec 2001)
Previous versions | rss
Add a publicationFeedback
Protein

Nuclear receptor-binding factor 2

Gene

NRBF2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

May modulate transcriptional activation by target nuclear receptors. Can act as transcriptional activator (in vitro).

1 Publication

Involved in starvation-induced autophagy probably by its association with PI3K complex I (PI3KC3-C1). However, effects has been described variably. Involved in the induction of starvation-induced autophagy (PubMed:24785657).

Stabilzes PI3KC3-C1 assembly and enhances ATG14-linked lipid kinase activity of PIK3C3 (By similarity).

Proposed to negatively regulate basal and starvation-induced autophagy and to inhibit PIK3C3 activity by modulating interactions in PI3KC3-C1 (PubMed:25086043).

May be involved in autophagosome biogenesis (PubMed:25086043).

May play a role in neural progenitor cell survival during differentiation (By similarity).

By similarity2 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processAutophagy, Transcription, Transcription regulation

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		Q96F24

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-383280, Nuclear Receptor transcription pathway

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...SignaLinki		Q96F24

SIGNOR Signaling Network Open Resource

More...SIGNORi		Q96F24

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Nuclear receptor-binding factor 2
Short name:
NRBF-2
Alternative name(s):
Comodulator of PPAR and RXR
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:NRBF2
Synonyms:COPR
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 10

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:19692, NRBF2

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		616477, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_Q96F24

Eukaryotic Pathogen, Vector and Host Database Resources

More...VEuPathDBi		HostDB:ENSG00000148572

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Keywords - Cellular componenti

Cytoplasm, Cytoplasmic vesicle, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology%5Fand%5Fbiotech%5Fsection">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi144 – 145LL → AA: Decreased interaction with nuclear receptors. 1 Publication2

Organism-specific databases

DisGeNET

More...DisGeNETi		29982

Open Targets

More...OpenTargetsi		ENSG00000148572

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA134946285

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		Q96F24, Tbio

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...ChEMBLi		CHEMBL4295924

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		NRBF2

Domain mapping of disease mutations (DMDM)

More...DMDMi		74731648

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002358161 – 287Nuclear receptor-binding factor 2Add BLAST287

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei113PhosphoserineCombined sources1
Modified residuei268PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...EPDi		Q96F24

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		Q96F24

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		Q96F24

MaxQB - The MaxQuant DataBase

More...MaxQBi		Q96F24

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q96F24

PeptideAtlas

More...PeptideAtlasi		Q96F24

PRoteomics IDEntifications database

More...PRIDEi		Q96F24

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		5374
76486 [Q96F24-1]
76487 [Q96F24-2]

PTM databases

GlyGen: Computational and Informatics Resources for Glycoscience

More...GlyGeni		Q96F24, 1 site, 1 O-linked glycan (1 site)

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q96F24

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q96F24

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Detected in keratinocytes, liver and placenta (PubMed:15610520). Expressed in a subset of cells in pediatric medulloblastoma (PubMed:18619852).2 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000148572, Expressed in blood and 231 other tissues

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q96F24, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000148572, Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with PPARA, PPARD and PPARG.

Interacts with RARA, RARG and RXRA in the presence of bound ligand (PubMed:15610520).

Interacts with SCOC (PubMed:22354037). Associates with the PI3K complex I (PI3KC3-C1); the direct binding partner in the complex is reported variably as PIK3R4 or ATG14 (PubMed:24785657).

4 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		119009, 58 interactors

Protein interaction database and analysis system

More...IntActi		Q96F24, 29 interactors

Molecular INTeraction database

More...MINTi		Q96F24

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000277746

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		Q96F24, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1287
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		Q96F24

Database of comparative protein structure models

More...ModBasei		Search...

Protein Data Bank in Europe - Knowledge Base

More...PDBe-KBi		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni83 – 122DisorderedSequence analysisAdd BLAST40

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and domains' section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili168 – 209Sequence analysisAdd BLAST42

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi141 – 145Nuclear receptor interaction motif5

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular type of amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi105 – 122Polar residuesSequence analysisAdd BLAST18

Keywords - Domaini

Coiled coil

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		ENOG502QRE0, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00390000000984

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_098323_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q96F24

Identification of Orthologs from Complete Genome Data

More...OMAi		TWQKFSA

Database of Orthologous Groups

More...OrthoDBi		1613014at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q96F24

TreeFam database of animal gene trees

More...TreeFami		TF328627

Family and domain databases

Intrinsically Disordered proteins with Extensive Annotations and Literature

More...IDEALi		IID00676

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR039679, NRBF2
IPR015056, NRBF2_C
IPR033393, NRBF2_MIT

The PANTHER Classification System

More...PANTHERi		PTHR14964, PTHR14964, 1 hit

Pfam protein domain database

More...Pfami		View protein in Pfam
PF08961, NRBF2, 1 hit
PF17169, NRBF2_MIT, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q96F24-1) [UniParc]FASTAAdd to basket
Also known as: COPR2, Comodulator of PPAR and RXR 2

This isoform has been chosen as the <p><strong>What is the canonical sequence?</strong><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MEVMEGPLNL AHQQSRRADR LLAAGKYEEA ISCHKKAAAY LSEAMKLTQS 
        60         70         80         90        100
EQAHLSLELQ RDSHMKQLLL IQERWKRAQR EERLKAQQNT DKDAAAHLQT 
       110        120        130        140        150
SHKPSAEDAE GQSPLSQKYS PSTEKCLPEI QGIFDRDPDT LLYLLQQKSE 
       160        170        180        190        200
PAEPCIGSKA PKDDKTIIEE QATKIADLKR HVEFLVAENE RLRKENKQLK 
       210        220        230        240        250
AEKARLLKGP IEKELDVDAD FVETSELWSL PPHAETATAS STWQKFAANT 
       260        270        280 
GKAKDIPIPN LPPLDFPSPE LPLMELSEDI LKGFMNN
Length:287
Mass (Da):32,378
Last modified:December 1, 2001 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i91EC0407F5108806
GO
Isoform 2 (identifier: Q96F24-2) [UniParc]FASTAAdd to basket
Also known as: COPR1, Comodulator of PPAR and RXR 1

The sequence of this isoform differs from the canonical sequence as follows:
     90-139: Missing.

Show »
Length:237
Mass (Da):26,955
Checksum:i71E24C3D4AB955B0
GO
Isoform 3 (identifier: Q96F24-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-38: MEVMEGPLNLAHQQSRRADRLLAAGKYEEAISCHKKAA → MFPGATTPLPKAAAYPGVYGSNGRTPQP

Show »
Length:277
Mass (Da):31,001
Checksum:iD1F2D74D45441391
GO

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAG44735 differs from that shown. Reason: Frameshift.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti150E → G in BAB70833 (PubMed:14702039).Curated1
Sequence conflicti284F → L in CAB66591 (PubMed:11230166).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0545551 – 38MEVME…HKKAA → MFPGATTPLPKAAAYPGVYG SNGRTPQP in isoform 3. 1 PublicationAdd BLAST38
Alternative sequenceiVSP_01848890 – 139Missing in isoform 2. 1 PublicationAdd BLAST50

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AY267839 mRNA Translation: AAP03081.1
AY267840 mRNA Translation: AAP03082.1
AF267866 mRNA Translation: AAG44735.1 Frameshift.
AL136656 mRNA Translation: CAB66591.1
AK054957 mRNA Translation: BAB70833.1
AK301656 mRNA Translation: BAG63132.1
AL590502 Genomic DNA No translation available.
CH471083 Genomic DNA Translation: EAW54241.1
BC011707 mRNA Translation: AAH11707.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS60537.1 [Q96F24-3]
CCDS7268.1 [Q96F24-1]

NCBI Reference Sequences

More...RefSeqi		NP_001269334.1, NM_001282405.1 [Q96F24-3]
NP_110386.2, NM_030759.4 [Q96F24-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000277746; ENSP00000277746; ENSG00000148572
ENST00000435510; ENSP00000397502; ENSG00000148572 [Q96F24-3]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		29982

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:29982

Matched Annotation from NCBI and EMBL-EBI (MANE) - Phase one

More...MANE-Selecti		ENST00000277746.11; ENSP00000277746.6; NM_030759.5; NP_110386.2

UCSC genome browser

More...UCSCi		uc001jmj.6, human [Q96F24-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY267839 mRNA Translation: AAP03081.1
AY267840 mRNA Translation: AAP03082.1
AF267866 mRNA Translation: AAG44735.1 Frameshift.
AL136656 mRNA Translation: CAB66591.1
AK054957 mRNA Translation: BAB70833.1
AK301656 mRNA Translation: BAG63132.1
AL590502 Genomic DNA No translation available.
CH471083 Genomic DNA Translation: EAW54241.1
BC011707 mRNA Translation: AAH11707.1
CCDSiCCDS60537.1 [Q96F24-3]
CCDS7268.1 [Q96F24-1]
RefSeqiNP_001269334.1, NM_001282405.1 [Q96F24-3]
NP_110386.2, NM_030759.4 [Q96F24-1]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...PDBei

Protein Data Bank RCSB

More...RCSB PDBi

Protein Data Bank Japan

More...PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
4ZEYX-ray1.50A4-86[»]
SMRiQ96F24
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGRIDi119009, 58 interactors
IntActiQ96F24, 29 interactors
MINTiQ96F24
STRINGi9606.ENSP00000277746

Chemistry databases

ChEMBLiCHEMBL4295924

PTM databases

GlyGeniQ96F24, 1 site, 1 O-linked glycan (1 site)
iPTMnetiQ96F24
PhosphoSitePlusiQ96F24

Genetic variation databases

BioMutaiNRBF2
DMDMi74731648

Proteomic databases

EPDiQ96F24
jPOSTiQ96F24
MassIVEiQ96F24
MaxQBiQ96F24
PaxDbiQ96F24
PeptideAtlasiQ96F24
PRIDEiQ96F24
ProteomicsDBi5374
76486 [Q96F24-1]
76487 [Q96F24-2]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		28311, 302 antibodies from 30 providers

The DNASU plasmid repository

More...DNASUi		29982

Genome annotation databases

EnsembliENST00000277746; ENSP00000277746; ENSG00000148572
ENST00000435510; ENSP00000397502; ENSG00000148572 [Q96F24-3]
GeneIDi29982
KEGGihsa:29982
MANE-SelectiENST00000277746.11; ENSP00000277746.6; NM_030759.5; NP_110386.2
UCSCiuc001jmj.6, human [Q96F24-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		29982
DisGeNETi29982

GeneCards: human genes, protein and diseases

More...GeneCardsi		NRBF2
HGNCiHGNC:19692, NRBF2
HPAiENSG00000148572, Low tissue specificity
MIMi616477, gene
neXtProtiNX_Q96F24
OpenTargetsiENSG00000148572
PharmGKBiPA134946285
VEuPathDBiHostDB:ENSG00000148572

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiENOG502QRE0, Eukaryota
GeneTreeiENSGT00390000000984
HOGENOMiCLU_098323_0_0_1
InParanoidiQ96F24
OMAiTWQKFSA
OrthoDBi1613014at2759
PhylomeDBiQ96F24
TreeFamiTF328627

Enzyme and pathway databases

PathwayCommonsiQ96F24
ReactomeiR-HSA-383280, Nuclear Receptor transcription pathway
SignaLinkiQ96F24
SIGNORiQ96F24

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		29982, 109 hits in 985 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		NRBF2, human

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		NRBF2

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		29982
PharosiQ96F24, Tbio

Protein Ontology

More...PROi		PR:Q96F24
RNActiQ96F24, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000148572, Expressed in blood and 231 other tissues
GenevisibleiQ96F24, HS

Family and domain databases

IDEALiIID00676
InterProiView protein in InterPro
IPR039679, NRBF2
IPR015056, NRBF2_C
IPR033393, NRBF2_MIT
PANTHERiPTHR14964, PTHR14964, 1 hit
PfamiView protein in Pfam
PF08961, NRBF2, 1 hit
PF17169, NRBF2_MIT, 1 hit

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiNRBF2_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q96F24
Secondary accession number(s): A6PW36
, B4DWS0, Q86UR2, Q96NP6, Q9H0S9, Q9H2I2
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 16, 2006
Last sequence update: December 1, 2001
Last modified: February 23, 2022
This is version 159 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Reference proteome

Documents

  1. Human chromosome 10
    Human chromosome 10: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again