Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - Q96F15 (GIMA5_HUMAN)

Entry version 140 (13 Feb 2019)
Sequence version 1 (01 Dec 2001)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

GTPase IMAP family member 5

Gene

GIMAP5

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Required for mitochondrial integrity and T-cell survival. May contribute to T-cell quiescence (By similarity).By similarity

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Function’ section describes the interaction between a single amino acid and another chemical entity. Priority is given to the annotation of physiological ligands.<p><a href='/help/binding' target='_top'>More...</a></p>Binding sitei55GTPBy similarity1
Binding sitei189GTPBy similarity1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Function’ section describes a region in the protein which binds nucleotide phosphates. It always involves more than one amino acid and includes all residues involved in nucleotide-binding.<p><a href='/help/np_bind' target='_top'>More...</a></p>Nucleotide bindingi34 – 42GTPBy similarity9
Nucleotide bindingi152 – 154GTPBy similarity3

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • GTP binding Source: GO_Central
View the complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

LigandGTP-binding, Nucleotide-binding

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
GTPase IMAP family member 5
Alternative name(s):
Immunity-associated nucleotide 4-like 1 protein
Immunity-associated nucleotide 5 protein
Short name:
IAN-5
Short name:
hIAN5
Immunity-associated protein 3
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:GIMAP5
Synonyms:IAN4L1, IAN5, IMAP3
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 7

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...EuPathDBi		HostDB:ENSG00000196329.11

Human Gene Nomenclature Database

More...HGNCi		HGNC:18005 GIMAP5

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		608086 gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_Q96F15

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini1 – 284CytoplasmicSequence analysisAdd BLAST284
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei285 – 305Helical; Anchor for type IV membrane proteinSequence analysisAdd BLAST21
Topological domaini306 – 307LumenalSequence analysis2

Keywords - Cellular componenti

Lysosome, Membrane, Mitochondrion, Mitochondrion outer membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...DisGeNETi		55340

Open Targets

More...OpenTargetsi		ENSG00000196329

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA29578

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		GIMAP5

Domain mapping of disease mutations (DMDM)

More...DMDMi		38372381

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001909901 – 307GTPase IMAP family member 5Add BLAST307

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		Q96F15

MaxQB - The MaxQuant DataBase

More...MaxQBi		Q96F15

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q96F15

PeptideAtlas

More...PeptideAtlasi		Q96F15

PRoteomics IDEntifications database

More...PRIDEi		Q96F15

ProteomicsDB human proteome resource

More...ProteomicsDBi		76484
76485 [Q96F15-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q96F15

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q96F15

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Widely expressed with high levels in lymph node and spleen. High expression found in CD4 and CD8-positive T-cells and monocytes with very low levels in B-lymphocytes. Highly expressed in B-lymphocyte-derived neoplasms.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000196329 Expressed in 90 organ(s), highest expression level in right lung

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		Q96F15 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q96F15 HS

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...BioGridi		120621, 13 interactors

Database of interacting proteins

More...DIPi		DIP-59484N

Protein interaction database and analysis system

More...IntActi		Q96F15, 50 interactors

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000351473

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...ProteinModelPortali		Q96F15

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		Q96F15

Database of comparative protein structure models

More...ModBasei		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini25 – 228AIG1-type GAdd BLAST204

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the TRAFAC class TrmE-Era-EngA-EngB-Septin-like GTPase superfamily. AIG1/Toc34/Toc159-like paraseptin GTPase family. IAN subfamily.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		ENOG410JA52 Eukaryota
ENOG411152A LUCA

Ensembl GeneTree

More...GeneTreei		ENSGT00940000154844

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		HOG000115747

The HOVERGEN Database of Homologous Vertebrate Genes

More...HOVERGENi		HBG004016

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q96F15

Database of Orthologous Groups

More...OrthoDBi		1092873at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q96F15

TreeFam database of animal gene trees

More...TreeFami		TF330845

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR006703 G_AIG1
IPR027417 P-loop_NTPase

Pfam protein domain database

More...Pfami		View protein in Pfam
PF04548 AIG1, 1 hit

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF52540 SSF52540, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS51720 G_AIG1, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q96F15-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MGGFQRGKYG TMAEGRSEDN LSATPPALRI ILVGKTGCGK SATGNSILGQ 
        60         70         80         90        100
PVFESKLRAQ SVTRTCQVKT GTWNGRKVLV VDTPSIFESQ ADTQELYKNI 
       110        120        130        140        150
GDCYLLSAPG PHVLLLVIQL GRFTAQDTVA IRKVKEVFGT GAMRHVVILF 
       160        170        180        190        200
THKEDLGGQA LDDYVANTDN CSLKDLVREC ERRYCAFNNW GSVEEQRQQQ 
       210        220        230        240        250
AELLAVIERL GREREGSFHS NDLFLDAQLL QRTGAGACQE DYRQYQAKVE 
       260        270        280        290        300
WQVEKHKQEL RENESNWAYK ALLRVKHLML LHYEIFVFLL LCSILFFIIF 

LFIFHYI
Length:307
Mass (Da):34,846
Last modified:December 1, 2001 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iD219F52DE910C5BA
GO
Isoform 2 (identifier: Q96F15-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-14: MGGFQRGKYGTMAE → MQDSPIVVCTLLCTHKYVYHSGEDVHSFHEITMNNDLTVLRIINLVRYKTSFST

Note: No experimental confirmation available.
Show »
Length:347
Mass (Da):39,584
Checksum:i9C2731FBA4341BC9
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti174K → E in BAA92115 (PubMed:14702039).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0089611 – 14MGGFQ…GTMAE → MQDSPIVVCTLLCTHKYVYH SGEDVHSFHEITMNNDLTVL RIINLVRYKTSFST in isoform 2. 1 PublicationAdd BLAST14

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AK002158 mRNA Translation: BAA92115.1
AK055568 mRNA Translation: BAB70958.1
CR457280 mRNA Translation: CAG33561.1
CH471173 Genomic DNA Translation: EAW54092.1
CH471173 Genomic DNA Translation: EAW54093.1
CH471173 Genomic DNA Translation: EAW54094.1
BC011732 mRNA Translation: AAH11732.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS5907.1 [Q96F15-1]

NCBI Reference Sequences

More...RefSeqi		NP_060854.2, NM_018384.4 [Q96F15-1]

UniGene gene-oriented nucleotide sequence clusters

More...UniGenei		Hs.647079
Hs.698139

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000358647; ENSP00000351473; ENSG00000196329 [Q96F15-1]
ENST00000498181; ENSP00000487840; ENSG00000196329 [Q96F15-1]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		55340

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:55340

UCSC genome browser

More...UCSCi		uc003whr.3 human [Q96F15-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK002158 mRNA Translation: BAA92115.1
AK055568 mRNA Translation: BAB70958.1
CR457280 mRNA Translation: CAG33561.1
CH471173 Genomic DNA Translation: EAW54092.1
CH471173 Genomic DNA Translation: EAW54093.1
CH471173 Genomic DNA Translation: EAW54094.1
BC011732 mRNA Translation: AAH11732.1
CCDSiCCDS5907.1 [Q96F15-1]
RefSeqiNP_060854.2, NM_018384.4 [Q96F15-1]
UniGeneiHs.647079
Hs.698139

3D structure databases

ProteinModelPortaliQ96F15
SMRiQ96F15
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi120621, 13 interactors
DIPiDIP-59484N
IntActiQ96F15, 50 interactors
STRINGi9606.ENSP00000351473

PTM databases

iPTMnetiQ96F15
PhosphoSitePlusiQ96F15

Polymorphism and mutation databases

BioMutaiGIMAP5
DMDMi38372381

Proteomic databases

jPOSTiQ96F15
MaxQBiQ96F15
PaxDbiQ96F15
PeptideAtlasiQ96F15
PRIDEiQ96F15
ProteomicsDBi76484
76485 [Q96F15-2]

Protocols and materials databases

The DNASU plasmid repository

More...DNASUi		55340
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000358647; ENSP00000351473; ENSG00000196329 [Q96F15-1]
ENST00000498181; ENSP00000487840; ENSG00000196329 [Q96F15-1]
GeneIDi55340
KEGGihsa:55340
UCSCiuc003whr.3 human [Q96F15-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		55340
DisGeNETi55340
EuPathDBiHostDB:ENSG00000196329.11

GeneCards: human genes, protein and diseases

More...GeneCardsi		GIMAP5
HGNCiHGNC:18005 GIMAP5
MIMi608086 gene
neXtProtiNX_Q96F15
OpenTargetsiENSG00000196329
PharmGKBiPA29578

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiENOG410JA52 Eukaryota
ENOG411152A LUCA
GeneTreeiENSGT00940000154844
HOGENOMiHOG000115747
HOVERGENiHBG004016
InParanoidiQ96F15
OrthoDBi1092873at2759
PhylomeDBiQ96F15
TreeFamiTF330845

Miscellaneous databases

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		GIMAP5

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		55340

Protein Ontology

More...PROi		PR:Q96F15

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000196329 Expressed in 90 organ(s), highest expression level in right lung
ExpressionAtlasiQ96F15 baseline and differential
GenevisibleiQ96F15 HS

Family and domain databases

InterProiView protein in InterPro
IPR006703 G_AIG1
IPR027417 P-loop_NTPase
PfamiView protein in Pfam
PF04548 AIG1, 1 hit
SUPFAMiSSF52540 SSF52540, 1 hit
PROSITEiView protein in PROSITE
PS51720 G_AIG1, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiGIMA5_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q96F15
Secondary accession number(s): D3DWZ5
, Q6IA75, Q96NE4, Q9NUK9
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 14, 2003
Last sequence update: December 1, 2001
Last modified: February 13, 2019
This is version 140 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 7
    Human chromosome 7: entries, gene names and cross-references to MIM
  2. SIMILARITY comments
    Index of protein domains and families
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again