Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

GTPase IMAP family member 5

Gene

GIMAP5

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Required for mitochondrial integrity and T-cell survival. May contribute to T-cell quiescence (By similarity).By similarity

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Binding sitei55GTPBy similarity1
Binding sitei189GTPBy similarity1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Nucleotide bindingi34 – 42GTPBy similarity9
Nucleotide bindingi152 – 154GTPBy similarity3

GO - Molecular functioni

Keywordsi

LigandGTP-binding, Nucleotide-binding

Names & Taxonomyi

Protein namesi
Recommended name:
GTPase IMAP family member 5
Alternative name(s):
Immunity-associated nucleotide 4-like 1 protein
Immunity-associated nucleotide 5 protein
Short name:
IAN-5
Short name:
hIAN5
Immunity-associated protein 3
Gene namesi
Name:GIMAP5
Synonyms:IAN4L1, IAN5, IMAP3
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 7

Organism-specific databases

EuPathDBiHostDB:ENSG00000196329.11
HGNCiHGNC:18005 GIMAP5
MIMi608086 gene
neXtProtiNX_Q96F15

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini1 – 284CytoplasmicSequence analysisAdd BLAST284
Transmembranei285 – 305Helical; Anchor for type IV membrane proteinSequence analysisAdd BLAST21
Topological domaini306 – 307LumenalSequence analysis2

Keywords - Cellular componenti

Lysosome, Membrane, Mitochondrion, Mitochondrion outer membrane

Pathology & Biotechi

Organism-specific databases

DisGeNETi55340
OpenTargetsiENSG00000196329
PharmGKBiPA29578

Polymorphism and mutation databases

BioMutaiGIMAP5
DMDMi38372381

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001909901 – 307GTPase IMAP family member 5Add BLAST307

Proteomic databases

MaxQBiQ96F15
PaxDbiQ96F15
PeptideAtlasiQ96F15
PRIDEiQ96F15
ProteomicsDBi76484
76485 [Q96F15-2]

PTM databases

iPTMnetiQ96F15
PhosphoSitePlusiQ96F15

Expressioni

Tissue specificityi

Widely expressed with high levels in lymph node and spleen. High expression found in CD4 and CD8-positive T-cells and monocytes with very low levels in B-lymphocytes. Highly expressed in B-lymphocyte-derived neoplasms.1 Publication

Gene expression databases

BgeeiENSG00000196329
CleanExiHS_GIMAP5
ExpressionAtlasiQ96F15 baseline and differential
GenevisibleiQ96F15 HS

Interactioni

Binary interactionsi

Show more details

Protein-protein interaction databases

BioGridi120621, 13 interactors
DIPiDIP-59484N
IntActiQ96F15, 50 interactors
STRINGi9606.ENSP00000351473

Structurei

3D structure databases

ProteinModelPortaliQ96F15
SMRiQ96F15
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini25 – 228AIG1-type GAdd BLAST204

Sequence similaritiesi

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiENOG410JA52 Eukaryota
ENOG411152A LUCA
GeneTreeiENSGT00760000118989
HOGENOMiHOG000115747
HOVERGENiHBG004016
InParanoidiQ96F15
OrthoDBiEOG091G0I0X
PhylomeDBiQ96F15
TreeFamiTF330845

Family and domain databases

InterProiView protein in InterPro
IPR006703 G_AIG1
IPR027417 P-loop_NTPase
PfamiView protein in Pfam
PF04548 AIG1, 1 hit
SUPFAMiSSF52540 SSF52540, 1 hit
PROSITEiView protein in PROSITE
PS51720 G_AIG1, 1 hit

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q96F15-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MGGFQRGKYG TMAEGRSEDN LSATPPALRI ILVGKTGCGK SATGNSILGQ
60 70 80 90 100
PVFESKLRAQ SVTRTCQVKT GTWNGRKVLV VDTPSIFESQ ADTQELYKNI
110 120 130 140 150
GDCYLLSAPG PHVLLLVIQL GRFTAQDTVA IRKVKEVFGT GAMRHVVILF
160 170 180 190 200
THKEDLGGQA LDDYVANTDN CSLKDLVREC ERRYCAFNNW GSVEEQRQQQ
210 220 230 240 250
AELLAVIERL GREREGSFHS NDLFLDAQLL QRTGAGACQE DYRQYQAKVE
260 270 280 290 300
WQVEKHKQEL RENESNWAYK ALLRVKHLML LHYEIFVFLL LCSILFFIIF

LFIFHYI
Length:307
Mass (Da):34,846
Last modified:December 1, 2001 - v1
Checksum:iD219F52DE910C5BA
GO
Isoform 2 (identifier: Q96F15-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-14: MGGFQRGKYGTMAE → MQDSPIVVCTLLCTHKYVYHSGEDVHSFHEITMNNDLTVLRIINLVRYKTSFST

Note: No experimental confirmation available.
Show »
Length:347
Mass (Da):39,584
Checksum:i9C2731FBA4341BC9
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti174K → E in BAA92115 (PubMed:14702039).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0089611 – 14MGGFQ…GTMAE → MQDSPIVVCTLLCTHKYVYH SGEDVHSFHEITMNNDLTVL RIINLVRYKTSFST in isoform 2. 1 PublicationAdd BLAST14

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK002158 mRNA Translation: BAA92115.1
AK055568 mRNA Translation: BAB70958.1
CR457280 mRNA Translation: CAG33561.1
CH471173 Genomic DNA Translation: EAW54092.1
CH471173 Genomic DNA Translation: EAW54093.1
CH471173 Genomic DNA Translation: EAW54094.1
BC011732 mRNA Translation: AAH11732.1
CCDSiCCDS5907.1 [Q96F15-1]
RefSeqiNP_060854.2, NM_018384.4 [Q96F15-1]
UniGeneiHs.647079
Hs.698139

Genome annotation databases

EnsembliENST00000358647; ENSP00000351473; ENSG00000196329 [Q96F15-1]
ENST00000498181; ENSP00000487840; ENSG00000196329 [Q96F15-1]
GeneIDi55340
KEGGihsa:55340
UCSCiuc003whr.3 human [Q96F15-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiGIMA5_HUMAN
AccessioniPrimary (citable) accession number: Q96F15
Secondary accession number(s): D3DWZ5
, Q6IA75, Q96NE4, Q9NUK9
Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 14, 2003
Last sequence update: December 1, 2001
Last modified: July 18, 2018
This is version 135 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 7
    Human chromosome 7: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health