Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 134 (17 Jun 2020)
Sequence version 1 (01 Dec 2001)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

HSPB1-associated protein 1

Gene

HSPBAP1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

May play a role in cellular stress response.By similarity

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
HSPB1-associated protein 1
Alternative name(s):
27 kDa heat shock protein-associated protein 1
Protein associated with small stress protein 1
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:HSPBAP1
Synonyms:PASS1
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 3

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000169087.10

Human Gene Nomenclature Database

More...
HGNCi
HGNC:16389 HSPBAP1

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
608263 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q96EW2

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Cytoplasm

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the 'Pathology and Biotech' section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

A chromosomal aberration involving HSPBAP1 has been found in a family with renal carcinoma (PubMed:12939738). Translocation t(2;3)(q35;q21) with the putative pseudogene DIRC3 (PubMed:12939738). Produces a hybrid mRNA encoding a truncated HSPBAP1 lacking the first 36 amino acids (PubMed:12939738).1 Publication

Organism-specific databases

DisGeNET

More...
DisGeNETi
79663

MalaCards human disease database

More...
MalaCardsi
HSPBAP1

Open Targets

More...
OpenTargetsi
ENSG00000169087

Orphanet; a database dedicated to information on rare diseases and orphan drugs

More...
Orphaneti
422526 Hereditary clear cell renal cell carcinoma

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA29515

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q96EW2 Tbio

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
HSPBAP1

Domain mapping of disease mutations (DMDM)

More...
DMDMi
74731618

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002841131 – 488HSPB1-associated protein 1Add BLAST488

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q96EW2

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q96EW2

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q96EW2

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q96EW2

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q96EW2

PeptideAtlas

More...
PeptideAtlasi
Q96EW2

PRoteomics IDEntifications database

More...
PRIDEi
Q96EW2

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
76457 [Q96EW2-1]
76458 [Q96EW2-2]
76459 [Q96EW2-3]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q96EW2

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q96EW2

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Widely expressed.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000169087 Expressed in oocyte and 206 other tissues

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q96EW2 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000169087 Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with CRYAB and HSPB1.

1 Publication

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
122788, 10 interactors

Protein interaction database and analysis system

More...
IntActi
Q96EW2, 7 interactors

Molecular INTeraction database

More...
MINTi
Q96EW2

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000302562

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q96EW2 protein

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini124 – 288JmjCPROSITE-ProRule annotationAdd BLAST165

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni88 – 208Interaction with HSPB1By similarityAdd BLAST121

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG2132 Eukaryota
ENOG410XQDR LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000159893

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_016785_5_1_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q96EW2

KEGG Orthology (KO)

More...
KOi
K19375

Identification of Orthologs from Complete Genome Data

More...
OMAi
DWPSRHW

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q96EW2

TreeFam database of animal gene trees

More...
TreeFami
TF315056

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR041667 Cupin_8
IPR013296 HSPB1-associated_protein_1
IPR003347 JmjC_dom

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF13621 Cupin_8, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR01886 PASS1

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00558 JmjC, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS51184 JMJC, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q96EW2-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAAGSEATTP VIVAAGAGGE EGEHVKPFKP EKAKEIIMSL QQPAIFCNMV
60 70 80 90 100
FDWPARHWNA KYLSQVLHGK QIRFRMGMKS MSTVPQFETT CNYVEATLEE
110 120 130 140 150
FLTWNCDQSS ISGPFRDYDH SKFWAYADYK YFVSLFEDKT DLFQDVKWSD
160 170 180 190 200
FGFPGRNGQE STLWIGSLGA HTPCHLDSYG CNLVFQVQGR KRWHLFPPED
210 220 230 240 250
TPFLYPTRIP YEESSVFSKI NVVNPDLKRF PQFRKAQRHA VTLSPGQVLF
260 270 280 290 300
VPRHWWHYVE SIDPVTVSIN SWIELEEDHL ARVEEAITRM LVCALKTAEN
310 320 330 340 350
PQNTRAWLNP TEVEETSHAV NCCYLNAAVS AFFDRCRTSE VVEIQALRTD
360 370 380 390 400
GEHMKKEELN VCNHMEVGQT GSQNLTTGTD KPEAASPFGP DLVPVAQRSE
410 420 430 440 450
EPPSERGGIF GSDGKDFVDK DGEHFGKLHC AKRQQIMSNS ENAIEEQIAS
460 470 480
NTTTTPQTFI STDDLLDCLV NPQVTRIVAQ LLIQGRSL
Length:488
Mass (Da):55,167
Last modified:December 1, 2001 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i504621FC6762F796
GO
Isoform 2 (identifier: Q96EW2-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     191-225: KRWHLFPPEDTPFLYPTRIPYEESSVFSKINVVNP → LECNGMIIAPGPQAILLPQPLKYLGLQETMASLSS
     226-488: Missing.

Show »
Length:225
Mass (Da):25,240
Checksum:i5725B9D6C9B86517
GO
Isoform 3 (identifier: Q96EW2-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     250-280: FVPRHWWHYVESIDPVTVSINSWIELEEDHL → ERKWQEGTQLLLLVKRRMDFGGRQSTRVIFI
     281-488: Missing.

Show »
Length:280
Mass (Da):32,266
Checksum:i695CE40384B215E2
GO

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAH17763 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti46F → L in BAC04847 (PubMed:14702039).Curated1
Sequence conflicti320V → A in AAM64044 (PubMed:11978969).Curated1
Sequence conflicti456P → PS in AAH17763 (PubMed:15489334).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_03170364S → A. Corresponds to variant dbSNP:rs16833517Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_024442191 – 225KRWHL…NVVNP → LECNGMIIAPGPQAILLPQP LKYLGLQETMASLSS in isoform 2. 1 PublicationAdd BLAST35
Alternative sequenceiVSP_024443226 – 488Missing in isoform 2. 1 PublicationAdd BLAST263
Alternative sequenceiVSP_024444250 – 280FVPRH…EEDHL → ERKWQEGTQLLLLVKRRMDF GGRQSTRVIFI in isoform 3. 1 PublicationAdd BLAST31
Alternative sequenceiVSP_024445281 – 488Missing in isoform 3. 1 PublicationAdd BLAST208

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF400663 mRNA Translation: AAM64044.1
AK096705 mRNA Translation: BAC04847.1
BC011897 mRNA Translation: AAH11897.1
BC017763 mRNA Translation: AAH17763.1 Different initiation.
BC063629 mRNA Translation: AAH63629.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS3017.1 [Q96EW2-1]

NCBI Reference Sequences

More...
RefSeqi
NP_001307657.1, NM_001320728.1
NP_078886.2, NM_024610.5 [Q96EW2-1]
XP_005247819.1, XM_005247762.2 [Q96EW2-3]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000306103; ENSP00000302562; ENSG00000169087 [Q96EW2-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
79663

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:79663

UCSC genome browser

More...
UCSCi
uc003efu.3 human [Q96EW2-1]

Keywords - Coding sequence diversityi

Alternative splicing, Chromosomal rearrangement, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross%5Freferences%5Fsection">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

Atlas of Genetics and Cytogenetics in Oncology and Haematology

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF400663 mRNA Translation: AAM64044.1
AK096705 mRNA Translation: BAC04847.1
BC011897 mRNA Translation: AAH11897.1
BC017763 mRNA Translation: AAH17763.1 Different initiation.
BC063629 mRNA Translation: AAH63629.1
CCDSiCCDS3017.1 [Q96EW2-1]
RefSeqiNP_001307657.1, NM_001320728.1
NP_078886.2, NM_024610.5 [Q96EW2-1]
XP_005247819.1, XM_005247762.2 [Q96EW2-3]

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

BioGRIDi122788, 10 interactors
IntActiQ96EW2, 7 interactors
MINTiQ96EW2
STRINGi9606.ENSP00000302562

PTM databases

iPTMnetiQ96EW2
PhosphoSitePlusiQ96EW2

Polymorphism and mutation databases

BioMutaiHSPBAP1
DMDMi74731618

Proteomic databases

EPDiQ96EW2
jPOSTiQ96EW2
MassIVEiQ96EW2
MaxQBiQ96EW2
PaxDbiQ96EW2
PeptideAtlasiQ96EW2
PRIDEiQ96EW2
ProteomicsDBi76457 [Q96EW2-1]
76458 [Q96EW2-2]
76459 [Q96EW2-3]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
16790 218 antibodies

The DNASU plasmid repository

More...
DNASUi
79663

Genome annotation databases

EnsembliENST00000306103; ENSP00000302562; ENSG00000169087 [Q96EW2-1]
GeneIDi79663
KEGGihsa:79663
UCSCiuc003efu.3 human [Q96EW2-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
79663
DisGeNETi79663
EuPathDBiHostDB:ENSG00000169087.10

GeneCards: human genes, protein and diseases

More...
GeneCardsi
HSPBAP1
HGNCiHGNC:16389 HSPBAP1
HPAiENSG00000169087 Low tissue specificity
MalaCardsiHSPBAP1
MIMi608263 gene
neXtProtiNX_Q96EW2
OpenTargetsiENSG00000169087
Orphaneti422526 Hereditary clear cell renal cell carcinoma
PharmGKBiPA29515

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG2132 Eukaryota
ENOG410XQDR LUCA
GeneTreeiENSGT00940000159893
HOGENOMiCLU_016785_5_1_1
InParanoidiQ96EW2
KOiK19375
OMAiDWPSRHW
PhylomeDBiQ96EW2
TreeFamiTF315056

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
79663 1 hit in 786 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
HSPBAP1 human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
79663
PharosiQ96EW2 Tbio

Protein Ontology

More...
PROi
PR:Q96EW2
RNActiQ96EW2 protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000169087 Expressed in oocyte and 206 other tissues
GenevisibleiQ96EW2 HS

Family and domain databases

InterProiView protein in InterPro
IPR041667 Cupin_8
IPR013296 HSPB1-associated_protein_1
IPR003347 JmjC_dom
PfamiView protein in Pfam
PF13621 Cupin_8, 1 hit
PRINTSiPR01886 PASS1
SMARTiView protein in SMART
SM00558 JmjC, 1 hit
PROSITEiView protein in PROSITE
PS51184 JMJC, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiHBAP1_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q96EW2
Secondary accession number(s): Q6P476
, Q8N8J4, Q8NHH6, Q8WWF0
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 17, 2007
Last sequence update: December 1, 2001
Last modified: June 17, 2020
This is version 134 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  2. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  4. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again