Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

E3 ubiquitin-protein ligase CHFR

Gene

CHFR

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

E3 ubiquitin-protein ligase that functions in the antephase checkpoint by actively delaying passage into mitosis in response to microtubule poisons. Acts in early prophase before chromosome condensation, when the centrosome move apart from each other along the periphery of the nucleus. Probably involved in signaling the presence of mitotic stress caused by microtubule poisons by mediating the 'Lys-48'-linked ubiquitination of target proteins, leading to their degradation by the proteasome. Promotes the ubiquitination and subsequent degradation of AURKA and PLK1. Probably acts as a tumor suppressor, possibly by mediating the polyubiquitination of HDAC1, leading to its degradation. May also promote the formation of 'Lys-63'-linked polyubiquitin chains and functions with the specific ubiquitin-conjugating UBC13-MMS2 (UBE2N-UBE2V2) heterodimer. Substrates that are polyubiquitinated at 'Lys-63' are usually not targeted for degradation, but are rather involved in signaling cellular stress.7 Publications

Miscellaneous

CHFR is silenced in many primary cancers because of CpG methylation and deacetylated histones on its promoter region. This however raises the question of whether CHFR silencing is a consequence or a cause of primary cancers.

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section describes the metabolic pathway(s) associated with a protein.<p><a href='/help/pathway' target='_top'>More...</a></p>Pathwayi: protein ubiquitination

This protein is involved in the pathway protein ubiquitination, which is part of Protein modification.
View all proteins of this organism that are known to be involved in the pathway protein ubiquitination and in Protein modification.

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Function’ section specifies the position(s) and type(s) of zinc fingers within the protein.<p><a href='/help/zn_fing' target='_top'>More...</a></p>Zinc fingeri304 – 343RING-typePROSITE-ProRule annotationAdd BLAST40
Zinc fingeri633 – 655PBZ-typeAdd BLAST23

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionTransferase
Biological processCell cycle, Cell division, Mitosis, Ubl conjugation pathway
LigandMetal-binding, Zinc

Enzyme and pathway databases

UniPathway: a resource for the exploration and annotation of metabolic pathways

More...
UniPathwayi
UPA00143

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
E3 ubiquitin-protein ligase CHFR (EC:2.3.2.275 Publications)
Alternative name(s):
Checkpoint with forkhead and RING finger domains protein
RING finger protein 196
RING-type E3 ubiquitin transferase CHFRCurated
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:CHFR
Synonyms:RNF196
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 12

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000072609.17

Human Gene Nomenclature Database

More...
HGNCi
HGNC:20455 CHFR

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
605209 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q96EP1

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi39T → A: Abolishes phosphorylation but not autoubiquitination; when associated with A-205. 1 Publication1
Mutagenesisi205S → A: Abolishes phosphorylation but not autoubiquitination; when associated with A-39. 1 Publication1
Mutagenesisi306I → A: Abolishes autoubiquitination. Does not affect phosphorylation. 2 Publications1
Mutagenesisi332W → A: Abolishes autoubiquitination in vitro. 1 Publication1
Mutagenesisi632R → A: Abolishes poly(ADP-ribose)-binding and poly-ADP-ribosylation by PARP1. 1 Publication1
Mutagenesisi635C → A: Abolishes poly(ADP-ribose)-binding and poly-ADP-ribosylation by PARP1; when associated with A-641. 1 Publication1
Mutagenesisi641C → A: Abolishes poly(ADP-ribose)-binding and poly-ADP-ribosylation by PARP1; when associated with A-635. 1 Publication1
Mutagenesisi642R → A: Impairs poly(ADP-ribose)-binding and poly-ADP-ribosylation by PARP1. 1 Publication1
Mutagenesisi644Q → A: Impairs poly(ADP-ribose)-binding and poly-ADP-ribosylation by PARP1. 1 Publication1

Organism-specific databases

DisGeNET

More...
DisGeNETi
55743

Open Targets

More...
OpenTargetsi
ENSG00000072609

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA134898949

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
CHFR

Domain mapping of disease mutations (DMDM)

More...
DMDMi
41688511

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000558721 – 664E3 ubiquitin-protein ligase CHFRAdd BLAST664

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei244PhosphoserineCombined sources1
Modified residuei386PhosphothreonineBy similarity1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Poly-ADP-ribosylated. In addition to binding non covalently poly(ADP-ribose) via its PBZ-type zinc finger, the protein is also covalently poly-ADP-ribosylated by PARP1.
Autoubiquitinated; may regulate its cellular level.3 Publications
Phosphorylated by PKB. Phosphorylation may affect its E3 ligase activity.2 Publications

Keywords - PTMi

ADP-ribosylation, Phosphoprotein, Ubl conjugation

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q96EP1

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q96EP1

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q96EP1

PeptideAtlas

More...
PeptideAtlasi
Q96EP1

PRoteomics IDEntifications database

More...
PRIDEi
Q96EP1

ProteomicsDB human proteome resource

More...
ProteomicsDBi
76432
76433 [Q96EP1-2]
76434 [Q96EP1-3]
76435 [Q96EP1-4]
76436 [Q96EP1-5]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q96EP1

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q96EP1

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Ubiquitous.1 Publication

<p>This subsection of the ‘Expression’ section provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified ‘at the protein level’.<p><a href='/help/developmental_stage' target='_top'>More...</a></p>Developmental stagei

Weakly expressed in G1 phase, and highly expressed during S phase.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000072609 Expressed in 214 organ(s), highest expression level in testis

CleanEx database of gene expression profiles

More...
CleanExi
HS_CHFR

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q96EP1 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q96EP1 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA045768
HPA073826

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with HDAC1 and HDAC2. Interacts with PML (with sumoylated form of PML).3 Publications

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
120861, 47 interactors

Database of interacting proteins

More...
DIPi
DIP-40098N

Protein interaction database and analysis system

More...
IntActi
Q96EP1, 20 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000392395

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1664
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1LGPX-ray2.00A14-128[»]
1LGQX-ray2.10A/B14-124[»]
2XOCX-ray1.89A/B407-664[»]
2XOYX-ray2.60A/B407-664[»]
2XOZX-ray2.37A/B407-664[»]
2XP0X-ray1.98A/B394-664[»]

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q96EP1

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q96EP1

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
Q96EP1

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini38 – 89FHAPROSITE-ProRule annotationAdd BLAST52

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The PBZ-type zinc finger (also named CYR) mediates non-covalent poly(ADP-ribose)-binding. Poly(ADP-ribose)-binding is dependent on the presence of zinc and is required for its function in antephase checkpoint.
The FHA domain plays a key role in the anti-proliferative properties of the protein and is involved in initiating a cell cycle arrest at G2/M. The FHA domain may be required to interact with phosphorylated proteins.

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the CHFR family.Curated

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri304 – 343RING-typePROSITE-ProRule annotationAdd BLAST40
Zinc fingeri633 – 655PBZ-typeAdd BLAST23

Keywords - Domaini

Zinc-finger

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG0802 Eukaryota
COG5243 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00400000022306

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG048005

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q96EP1

KEGG Orthology (KO)

More...
KOi
K10644

Identification of Orthologs from Complete Genome Data

More...
OMAi
HLYWGCA

Database of Orthologous Groups

More...
OrthoDBi
1506037at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q96EP1

TreeFam database of animal gene trees

More...
TreeFami
TF330957

Family and domain databases

Conserved Domains Database

More...
CDDi
cd00060 FHA, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
3.30.40.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR019406 APLF_PBZ
IPR000253 FHA_dom
IPR008984 SMAD_FHA_dom_sf
IPR001841 Znf_RING
IPR013083 Znf_RING/FYVE/PHD
IPR017907 Znf_RING_CS

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00498 FHA, 1 hit
PF10283 zf-CCHH, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00240 FHA, 1 hit
SM00184 RING, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF49879 SSF49879, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50006 FHA_DOMAIN, 1 hit
PS00518 ZF_RING_1, 1 hit
PS50089 ZF_RING_2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 5 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 8 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q96EP1-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MERPEEGKQS PPPQPWGRLL RLGAEEGEPH VLLRKREWTI GRRRGCDLSF
60 70 80 90 100
PSNKLVSGDH CRIVVDEKSG QVTLEDTSTS GTVINKLKVV KKQTCPLQTG
110 120 130 140 150
DVIYLVYRKN EPEHNVAYLY ESLSEKQGMT QESFEANKEN VFHGTKDTSG
160 170 180 190 200
AGAGRGADPR VPPSSPATQV CFEEPQPSTS TSDLFPTASA SSTEPSPAGR
210 220 230 240 250
ERSSSCGSGG GGISPKGSGP SVASDEVSSF ASALPDRKTA SFSSLEPQDQ
260 270 280 290 300
EDLEPVKKKM RGDGDLDLNG QLLVAQPRRN AQTVHEDVRA AAGKPDKMEE
310 320 330 340 350
TLTCIICQDL LHDCVSLQPC MHTFCAACYS GWMERSSLCP TCRCPVERIC
360 370 380 390 400
KNHILNNLVE AYLIQHPDKS RSEEDVQSMD ARNKITQDML QPKVRRSFSD
410 420 430 440 450
EEGSSEDLLE LSDVDSESSD ISQPYVVCRQ CPEYRRQAAQ PPHCPAPEGE
460 470 480 490 500
PGAPQALGDA PSTSVSLTTA VQDYVCPLQG SHALCTCCFQ PMPDRRAERE
510 520 530 540 550
QDPRVAPQQC AVCLQPFCHL YWGCTRTGCY GCLAPFCELN LGDKCLDGVL
560 570 580 590 600
NNNSYESDIL KNYLATRGLT WKNMLTESLV ALQRGVFLLS DYRVTGDTVL
610 620 630 640 650
CYCCGLRSFR ELTYQYRQNI PASELPVAVT SRPDCYWGRN CRTQVKAHHA
660
MKFNHICEQT RFKN
Length:664
Mass (Da):73,386
Last modified:February 2, 2004 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i141A1E7FEFAE36A2
GO
Isoform 2 (identifier: Q96EP1-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     135-146: Missing.

Show »
Length:652
Mass (Da):72,031
Checksum:i572F2CE6D1743D80
GO
Isoform 3 (identifier: Q96EP1-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     136-206: ANKENVFHGT...PAGRERSSSC → MVPCCVAQAGLKLLGSSDPPTLASQSIVIT

Show »
Length:623
Mass (Da):69,192
Checksum:iB747CD23B74368E7
GO
Isoform 4 (identifier: Q96EP1-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     470-470: Missing.

Show »
Length:663
Mass (Da):73,315
Checksum:i302207777755B60C
GO
Isoform 5 (identifier: Q96EP1-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     115-207: NVAYLYESLS...AGRERSSSCG → R

Note: No experimental confirmation available.
Show »
Length:572
Mass (Da):63,873
Checksum:iC3CFDEF89A9C85B7
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 8 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
F5GWH4F5GWH4_HUMAN
E3 ubiquitin-protein ligase CHFR
CHFR
223Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A096P6K8A0A096P6K8_HUMAN
E3 ubiquitin-protein ligase CHFR
CHFR
349Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A087X0W6A0A087X0W6_HUMAN
E3 ubiquitin-protein ligase CHFR
CHFR
75Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A087WUN4A0A087WUN4_HUMAN
E3 ubiquitin-protein ligase CHFR
CHFR
60Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F5H829F5H829_HUMAN
E3 ubiquitin-protein ligase CHFR
CHFR
71Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F5H375F5H375_HUMAN
E3 ubiquitin-protein ligase CHFR
CHFR
136Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F5H5P5F5H5P5_HUMAN
E3 ubiquitin-protein ligase CHFR
CHFR
25Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
U3KPU9U3KPU9_HUMAN
E3 ubiquitin-protein ligase CHFR
CHFR
31Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti256V → E in BAA91817 (PubMed:14702039).Curated1
Sequence conflicti462S → P in BAA91817 (PubMed:14702039).Curated1
Sequence conflicti599V → A in BAG65178 (PubMed:14702039).Curated1
Sequence conflicti617R → Q in BAA91817 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_017582166P → L in a patient with non small cell lung carcinomas; homozygous. 1 PublicationCorresponds to variant dbSNP:rs1176037831Ensembl.1
Natural variantiVAR_017583202R → P in a patient with non small cell lung carcinomas. 1 Publication1
Natural variantiVAR_017584270G → R1 PublicationCorresponds to variant dbSNP:rs115096950Ensembl.1
Natural variantiVAR_017585497A → V Common polymorphism. 2 PublicationsCorresponds to variant dbSNP:rs2306541Ensembl.1
Natural variantiVAR_017586536F → S in a patient with non small cell lung carcinomas. 1 Publication1
Natural variantiVAR_017587580V → M Common polymorphism. 3 PublicationsCorresponds to variant dbSNP:rs2306536Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_038126115 – 207NVAYL…SSSCG → R in isoform 5. CuratedAdd BLAST93
Alternative sequenceiVSP_009349135 – 146Missing in isoform 2. 2 PublicationsAdd BLAST12
Alternative sequenceiVSP_009350136 – 206ANKEN…RSSSC → MVPCCVAQAGLKLLGSSDPP TLASQSIVIT in isoform 3. 1 PublicationAdd BLAST71
Alternative sequenceiVSP_038127470Missing in isoform 4. 1 Publication1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF170724 mRNA Translation: AAF91084.1
AK001658 mRNA Translation: BAA91817.1
AK027687 mRNA Translation: BAB55297.1
AK302785 mRNA Translation: BAG63989.1
AK304333 mRNA Translation: BAG65178.1
AC127070 Genomic DNA No translation available.
BC012072 mRNA Translation: AAH12072.1
AL137561 mRNA Translation: CAB70812.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS31937.1 [Q96EP1-3]
CCDS53847.1 [Q96EP1-5]
CCDS53848.1 [Q96EP1-2]
CCDS53849.1 [Q96EP1-1]

Protein sequence database of the Protein Information Resource

More...
PIRi
T46399

NCBI Reference Sequences

More...
RefSeqi
NP_001154816.1, NM_001161344.1 [Q96EP1-1]
NP_001154817.1, NM_001161345.1 [Q96EP1-4]
NP_001154818.1, NM_001161346.1 [Q96EP1-2]
NP_001154819.1, NM_001161347.1 [Q96EP1-5]
NP_060693.2, NM_018223.2 [Q96EP1-3]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.720197

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000266880; ENSP00000266880; ENSG00000072609 [Q96EP1-3]
ENST00000432561; ENSP00000392395; ENSG00000072609 [Q96EP1-1]
ENST00000443047; ENSP00000416431; ENSG00000072609 [Q96EP1-5]
ENST00000450056; ENSP00000398735; ENSG00000072609 [Q96EP1-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
55743

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:55743

UCSC genome browser

More...
UCSCi
uc001uld.3 human [Q96EP1-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross_references_section">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

Atlas of Genetics and Cytogenetics in Oncology and Haematology

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF170724 mRNA Translation: AAF91084.1
AK001658 mRNA Translation: BAA91817.1
AK027687 mRNA Translation: BAB55297.1
AK302785 mRNA Translation: BAG63989.1
AK304333 mRNA Translation: BAG65178.1
AC127070 Genomic DNA No translation available.
BC012072 mRNA Translation: AAH12072.1
AL137561 mRNA Translation: CAB70812.1
CCDSiCCDS31937.1 [Q96EP1-3]
CCDS53847.1 [Q96EP1-5]
CCDS53848.1 [Q96EP1-2]
CCDS53849.1 [Q96EP1-1]
PIRiT46399
RefSeqiNP_001154816.1, NM_001161344.1 [Q96EP1-1]
NP_001154817.1, NM_001161345.1 [Q96EP1-4]
NP_001154818.1, NM_001161346.1 [Q96EP1-2]
NP_001154819.1, NM_001161347.1 [Q96EP1-5]
NP_060693.2, NM_018223.2 [Q96EP1-3]
UniGeneiHs.720197

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1LGPX-ray2.00A14-128[»]
1LGQX-ray2.10A/B14-124[»]
2XOCX-ray1.89A/B407-664[»]
2XOYX-ray2.60A/B407-664[»]
2XOZX-ray2.37A/B407-664[»]
2XP0X-ray1.98A/B394-664[»]
ProteinModelPortaliQ96EP1
SMRiQ96EP1
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi120861, 47 interactors
DIPiDIP-40098N
IntActiQ96EP1, 20 interactors
STRINGi9606.ENSP00000392395

PTM databases

iPTMnetiQ96EP1
PhosphoSitePlusiQ96EP1

Polymorphism and mutation databases

BioMutaiCHFR
DMDMi41688511

Proteomic databases

EPDiQ96EP1
MaxQBiQ96EP1
PaxDbiQ96EP1
PeptideAtlasiQ96EP1
PRIDEiQ96EP1
ProteomicsDBi76432
76433 [Q96EP1-2]
76434 [Q96EP1-3]
76435 [Q96EP1-4]
76436 [Q96EP1-5]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
55743
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000266880; ENSP00000266880; ENSG00000072609 [Q96EP1-3]
ENST00000432561; ENSP00000392395; ENSG00000072609 [Q96EP1-1]
ENST00000443047; ENSP00000416431; ENSG00000072609 [Q96EP1-5]
ENST00000450056; ENSP00000398735; ENSG00000072609 [Q96EP1-2]
GeneIDi55743
KEGGihsa:55743
UCSCiuc001uld.3 human [Q96EP1-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
55743
DisGeNETi55743
EuPathDBiHostDB:ENSG00000072609.17

GeneCards: human genes, protein and diseases

More...
GeneCardsi
CHFR
HGNCiHGNC:20455 CHFR
HPAiHPA045768
HPA073826
MIMi605209 gene
neXtProtiNX_Q96EP1
OpenTargetsiENSG00000072609
PharmGKBiPA134898949

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG0802 Eukaryota
COG5243 LUCA
GeneTreeiENSGT00400000022306
HOVERGENiHBG048005
InParanoidiQ96EP1
KOiK10644
OMAiHLYWGCA
OrthoDBi1506037at2759
PhylomeDBiQ96EP1
TreeFamiTF330957

Enzyme and pathway databases

UniPathwayi
UPA00143

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
CHFR human
EvolutionaryTraceiQ96EP1

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
CHFR

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
55743

Protein Ontology

More...
PROi
PR:Q96EP1

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000072609 Expressed in 214 organ(s), highest expression level in testis
CleanExiHS_CHFR
ExpressionAtlasiQ96EP1 baseline and differential
GenevisibleiQ96EP1 HS

Family and domain databases

CDDicd00060 FHA, 1 hit
Gene3Di3.30.40.10, 1 hit
InterProiView protein in InterPro
IPR019406 APLF_PBZ
IPR000253 FHA_dom
IPR008984 SMAD_FHA_dom_sf
IPR001841 Znf_RING
IPR013083 Znf_RING/FYVE/PHD
IPR017907 Znf_RING_CS
PfamiView protein in Pfam
PF00498 FHA, 1 hit
PF10283 zf-CCHH, 1 hit
SMARTiView protein in SMART
SM00240 FHA, 1 hit
SM00184 RING, 1 hit
SUPFAMiSSF49879 SSF49879, 1 hit
PROSITEiView protein in PROSITE
PS50006 FHA_DOMAIN, 1 hit
PS00518 ZF_RING_1, 1 hit
PS50089 ZF_RING_2, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiCHFR_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q96EP1
Secondary accession number(s): A6NEN5
, B4DZ77, B4E2L6, Q96SL3, Q9NRT4, Q9NT32, Q9NVD5
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 2, 2004
Last sequence update: February 2, 2004
Last modified: January 16, 2019
This is version 169 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  6. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  7. Human chromosome 12
    Human chromosome 12: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again