Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Leucine-rich repeat-containing protein 51

Gene

LRTOMT

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at transcript leveli

Functioni

Miscellaneous

In primates, this protein is produced by a bicistronic gene which also produces the TOMT protein from an overlapping reading frame. In rodents, these proteins are produced by 2 separate adjacent genes which together are orthologous to the single primate gene.

Names & Taxonomyi

Protein namesi
Recommended name:
Leucine-rich repeat-containing protein 51
Alternative name(s):
Protein LRTOMT1
Gene namesi
Name:LRTOMT
Synonyms:LRRC51
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 11

Organism-specific databases

EuPathDBiHostDB:ENSG00000184154.12
HGNCiHGNC:25033 LRTOMT
MIMi612414 gene
neXtProtiNX_Q96E66

Subcellular locationi

Keywords - Cellular componenti

Cytoplasm

Pathology & Biotechi

Organism-specific databases

DisGeNETi220074
GeneReviewsiLRTOMT
MalaCardsiLRTOMT
OpenTargetsiENSG00000184154
PharmGKBiPA164722133

Polymorphism and mutation databases

DMDMi74760801

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002255001 – 192Leucine-rich repeat-containing protein 51Add BLAST192

Proteomic databases

EPDiQ96E66
PeptideAtlasiQ96E66
PRIDEiQ96E66
ProteomicsDBi76377
76378 [Q96E66-2]
76379 [Q96E66-3]
76380 [Q96E66-4]
76381 [Q96E66-5]
76382 [Q96E66-6]

PTM databases

iPTMnetiQ96E66
PhosphoSitePlusiQ96E66

Expressioni

Gene expression databases

BgeeiENSG00000184154 Expressed in 122 organ(s), highest expression level in testis
CleanExiHS_LRTOMT
ExpressionAtlasiQ96E66 baseline and differential
GenevisibleiQ96E66 HS

Organism-specific databases

HPAiHPA039949

Interactioni

Protein-protein interaction databases

BioGridi128624, 2 interactors
IntActiQ96E66, 1 interactor

Structurei

3D structure databases

ProteinModelPortaliQ96E66
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Repeati49 – 71LRR 1Add BLAST23
Repeati80 – 101LRR 2Add BLAST22
Repeati103 – 124LRR 3Add BLAST22
Domaini137 – 175LRRCTAdd BLAST39

Keywords - Domaini

Leucine-rich repeat, Repeat

Phylogenomic databases

GeneTreeiENSGT00390000011316
ENSGT00510000047925
HOVERGENiHBG055282
PhylomeDBiQ96E66

Family and domain databases

Gene3Di3.80.10.10, 1 hit
InterProiView protein in InterPro
IPR001611 Leu-rich_rpt
IPR032675 LRR_dom_sf
PROSITEiView protein in PROSITE
PS51450 LRR, 4 hits

Sequences (6+)i

Sequence statusi: Complete.

This entry describes 6 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 6 described isoforms and 6 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q96E66-1) [UniParc]FASTAAdd to basket
Also known as: A

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MNKRDYMNTS VQEPPLDYSF RSIHVIQDLV NEEPRTGLRP LKRSKSGKSL
60 70 80 90 100
TQSLWLNNNV LNDLRDFNQV ASQLLEHPEN LAWIDLSFND LTSIDPVLTT
110 120 130 140 150
FFNLSVLYLH GNSIQRLGEV NKLAVLPRLR SLTLHGNPME EEKGYRQYVL
160 170 180 190
CTLSRITTFD FSGVTKADRT TAEVWKRMNI KPKKAWTKQN TL
Length:192
Mass (Da):22,206
Last modified:December 1, 2001 - v1
Checksum:iFABF76A0C1F53A67
GO
Isoform 2 (identifier: Q96E66-2) [UniParc]FASTAAdd to basket
Also known as: B

The sequence of this isoform differs from the canonical sequence as follows:
     147-192: QYVLCTLSRITTFDFSGVTKADRTTAEVWKRMNIKPKKAWTKQNTL → VPGSVEMPHRPP

Show »
Length:158
Mass (Da):18,132
Checksum:i6AC861EC2136838F
GO
Isoform 3 (identifier: Q96E66-3) [UniParc]FASTAAdd to basket
Also known as: C

The sequence of this isoform differs from the canonical sequence as follows:
     147-192: Missing.

Show »
Length:146
Mass (Da):16,847
Checksum:i8771D5BEABC3F9D4
GO
Isoform 4 (identifier: Q96E66-4) [UniParc]FASTAAdd to basket
Also known as: D

The sequence of this isoform differs from the canonical sequence as follows:
     146-192: RQYVLCTLSR...KKAWTKQNTL → SRPWTPRPVL...QLRAHPCPAR

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Show »
Length:227
Mass (Da):24,914
Checksum:i70FB60750230B106
GO
Isoform 5 (identifier: Q96E66-5) [UniParc]FASTAAdd to basket
Also known as: E

The sequence of this isoform differs from the canonical sequence as follows:
     146-192: RQYVLCTLSR...KKAWTKQNTL → SRPWTPRPVL...QLRAHPCPAR

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Show »
Length:187
Mass (Da):21,180
Checksum:i54C4AD20E1AF207C
GO
Isoform 6 (identifier: Q96E66-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-27: MNKRDYMNTSVQEPPLDYSFRSIHVIQ → MVEFQPSVT

Show »
Length:174
Mass (Da):19,974
Checksum:iE54E485D62E670E9
GO

Computationally mapped potential isoform sequencesi

There are 6 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
Q8WZ04TOMT_HUMAN
Transmembrane O-methyltransferase
LRTOMT COMT2, TOMT, PP7517
291Annotation score:
F5GYI0F5GYI0_HUMAN
Leucine-rich repeat-containing prot...
LRTOMT
103Annotation score:
F5H614F5H614_HUMAN
Leucine-rich repeat-containing prot...
LRTOMT
65Annotation score:
F5H6F7F5H6F7_HUMAN
cDNA, FLJ79541, highly similar to L...
LRTOMT
54Annotation score:
F5H6K5F5H6K5_HUMAN
Leucine-rich repeat-containing prot...
LRTOMT
38Annotation score:
F5H0M6F5H0M6_HUMAN
Leucine-rich repeat-containing prot...
LRTOMT
92Annotation score:

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti12Q → R in BAG35968 (PubMed:14702039).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0418521 – 27MNKRD…IHVIQ → MVEFQPSVT in isoform 6. 1 PublicationAdd BLAST27
Alternative sequenceiVSP_036893146 – 192RQYVL…KQNTL → SRPWTPRPVLCSGPPAQGPG RDHVPCHCIGLPATGGNIAG AVPALLPIAGAHGLAAKPPR LPVRAADRGAGLQLRAHPCP AR in isoform 4. 1 PublicationAdd BLAST47
Alternative sequenceiVSP_036894146 – 192RQYVL…KQNTL → SRPWTPRPVLCSGPPAQPPR LPVRAADRGAGLQLRAHPCP AR in isoform 5. 1 PublicationAdd BLAST47
Alternative sequenceiVSP_036895147 – 192QYVLC…KQNTL → VPGSVEMPHRPP in isoform 2. 1 PublicationAdd BLAST46
Alternative sequenceiVSP_036896147 – 192Missing in isoform 3. 1 PublicationAdd BLAST46

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
EU627066 mRNA Translation: ACF40876.1
EU627067 mRNA Translation: ACF40877.1
EU627068 mRNA Translation: ACF40878.1
EU627069 mRNA Translation: ACF40879.1
EU627070 mRNA Translation: ACF40880.1
AK298997 mRNA Translation: BAH12920.1
AK313150 mRNA Translation: BAG35968.1
AP000812 Genomic DNA No translation available.
AP002490 Genomic DNA No translation available.
CH471076 Genomic DNA Translation: EAW74832.1
BC012855 mRNA Translation: AAH12855.1
CCDSiCCDS44667.1 [Q96E66-2]
CCDS55778.1 [Q96E66-6]
CCDS59227.1 [Q96E66-3]
CCDS8208.1 [Q96E66-1]
RefSeqiNP_001138779.1, NM_001145307.4 [Q96E66-2]
NP_001192067.1, NM_001205138.3 [Q96E66-6]
NP_001258400.1, NM_001271471.2 [Q96E66-3]
NP_001305732.1, NM_001318803.1 [Q96E66-1]
NP_660352.1, NM_145309.5 [Q96E66-1]
XP_006718536.1, XM_006718473.3 [Q96E66-1]
XP_006718537.1, XM_006718474.3 [Q96E66-1]
XP_011543149.1, XM_011544847.2 [Q96E66-1]
XP_011543150.1, XM_011544848.2 [Q96E66-1]
XP_016872848.1, XM_017017359.1
XP_016872849.1, XM_017017360.1
UniGeneiHs.317243
Hs.667985

Genome annotation databases

EnsembliENST00000289488; ENSP00000289488; ENSG00000184154 [Q96E66-1]
ENST00000324866; ENSP00000440693; ENSG00000184154 [Q96E66-3]
ENST00000423494; ENSP00000441249; ENSG00000184154 [Q96E66-6]
ENST00000447974; ENSP00000414271; ENSG00000184154 [Q96E66-1]
ENST00000536917; ENSP00000443421; ENSG00000184154 [Q96E66-3]
ENST00000538413; ENSP00000438762; ENSG00000184154 [Q96E66-1]
ENST00000538478; ENSP00000444583; ENSG00000184154 [Q96E66-1]
ENST00000541614; ENSP00000438522; ENSG00000184154 [Q96E66-2]
ENST00000615940; ENSP00000482923; ENSG00000184154 [Q96E66-6]
ENST00000642648; ENSP00000494362; ENSG00000184154 [Q96E66-1]
ENST00000647530; ENSP00000494072; ENSG00000184154 [Q96E66-1]
GeneIDi220074
UCSCiuc001orr.4 human [Q96E66-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
EU627066 mRNA Translation: ACF40876.1
EU627067 mRNA Translation: ACF40877.1
EU627068 mRNA Translation: ACF40878.1
EU627069 mRNA Translation: ACF40879.1
EU627070 mRNA Translation: ACF40880.1
AK298997 mRNA Translation: BAH12920.1
AK313150 mRNA Translation: BAG35968.1
AP000812 Genomic DNA No translation available.
AP002490 Genomic DNA No translation available.
CH471076 Genomic DNA Translation: EAW74832.1
BC012855 mRNA Translation: AAH12855.1
CCDSiCCDS44667.1 [Q96E66-2]
CCDS55778.1 [Q96E66-6]
CCDS59227.1 [Q96E66-3]
CCDS8208.1 [Q96E66-1]
RefSeqiNP_001138779.1, NM_001145307.4 [Q96E66-2]
NP_001192067.1, NM_001205138.3 [Q96E66-6]
NP_001258400.1, NM_001271471.2 [Q96E66-3]
NP_001305732.1, NM_001318803.1 [Q96E66-1]
NP_660352.1, NM_145309.5 [Q96E66-1]
XP_006718536.1, XM_006718473.3 [Q96E66-1]
XP_006718537.1, XM_006718474.3 [Q96E66-1]
XP_011543149.1, XM_011544847.2 [Q96E66-1]
XP_011543150.1, XM_011544848.2 [Q96E66-1]
XP_016872848.1, XM_017017359.1
XP_016872849.1, XM_017017360.1
UniGeneiHs.317243
Hs.667985

3D structure databases

ProteinModelPortaliQ96E66
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi128624, 2 interactors
IntActiQ96E66, 1 interactor

PTM databases

iPTMnetiQ96E66
PhosphoSitePlusiQ96E66

Polymorphism and mutation databases

DMDMi74760801

Proteomic databases

EPDiQ96E66
PeptideAtlasiQ96E66
PRIDEiQ96E66
ProteomicsDBi76377
76378 [Q96E66-2]
76379 [Q96E66-3]
76380 [Q96E66-4]
76381 [Q96E66-5]
76382 [Q96E66-6]

Protocols and materials databases

DNASUi220074
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000289488; ENSP00000289488; ENSG00000184154 [Q96E66-1]
ENST00000324866; ENSP00000440693; ENSG00000184154 [Q96E66-3]
ENST00000423494; ENSP00000441249; ENSG00000184154 [Q96E66-6]
ENST00000447974; ENSP00000414271; ENSG00000184154 [Q96E66-1]
ENST00000536917; ENSP00000443421; ENSG00000184154 [Q96E66-3]
ENST00000538413; ENSP00000438762; ENSG00000184154 [Q96E66-1]
ENST00000538478; ENSP00000444583; ENSG00000184154 [Q96E66-1]
ENST00000541614; ENSP00000438522; ENSG00000184154 [Q96E66-2]
ENST00000615940; ENSP00000482923; ENSG00000184154 [Q96E66-6]
ENST00000642648; ENSP00000494362; ENSG00000184154 [Q96E66-1]
ENST00000647530; ENSP00000494072; ENSG00000184154 [Q96E66-1]
GeneIDi220074
UCSCiuc001orr.4 human [Q96E66-1]

Organism-specific databases

CTDi220074
DisGeNETi220074
EuPathDBiHostDB:ENSG00000184154.12
GeneCardsiENSG00000284922
LRTOMT
GeneReviewsiLRTOMT
HGNCiHGNC:25033 LRTOMT
HPAiHPA039949
MalaCardsiLRTOMT
MIMi612414 gene
neXtProtiNX_Q96E66
OpenTargetsiENSG00000184154
PharmGKBiPA164722133
GenAtlasiSearch...

Phylogenomic databases

GeneTreeiENSGT00390000011316
ENSGT00510000047925
HOVERGENiHBG055282
PhylomeDBiQ96E66

Miscellaneous databases

ChiTaRSiLRTOMT human
GenomeRNAii220074
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000184154 Expressed in 122 organ(s), highest expression level in testis
CleanExiHS_LRTOMT
ExpressionAtlasiQ96E66 baseline and differential
GenevisibleiQ96E66 HS

Family and domain databases

Gene3Di3.80.10.10, 1 hit
InterProiView protein in InterPro
IPR001611 Leu-rich_rpt
IPR032675 LRR_dom_sf
PROSITEiView protein in PROSITE
PS51450 LRR, 4 hits
ProtoNetiSearch...

Entry informationi

Entry nameiLRC51_HUMAN
AccessioniPrimary (citable) accession number: Q96E66
Secondary accession number(s): B2R7X1
, B6CZ35, B6CZ36, B6CZ37, B6CZ38, B6CZ39, B7Z5I4
Entry historyiIntegrated into UniProtKB/Swiss-Prot: March 7, 2006
Last sequence update: December 1, 2001
Last modified: November 7, 2018
This is version 134 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  2. Human chromosome 11
    Human chromosome 11: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again