Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 144 (17 Jun 2020)
Sequence version 1 (01 Dec 2001)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Leucine-rich repeat-containing protein 51

Gene

LRTOMT

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Miscellaneous

In primates, this protein is produced by a bicistronic gene which also produces the TOMT protein from an overlapping reading frame. In rodents, these proteins are produced by 2 separate adjacent genes which together are orthologous to the single primate gene.

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Leucine-rich repeat-containing protein 51
Alternative name(s):
Protein LRTOMT1
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:LRTOMT
Synonyms:LRRC51
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 11

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000184154.12

Human Gene Nomenclature Database

More...
HGNCi
HGNC:25033 LRTOMT

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
612414 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q96E66

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Cytoplasm

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
220074

GeneReviews a resource of expert-authored, peer-reviewed disease descriptions.

More...
GeneReviewsi
LRTOMT

MalaCards human disease database

More...
MalaCardsi
LRTOMT

Open Targets

More...
OpenTargetsi
ENSG00000184154

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA164722133

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q96E66 Tbio

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
LRTOMT

Domain mapping of disease mutations (DMDM)

More...
DMDMi
74760801

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002255001 – 192Leucine-rich repeat-containing protein 51Add BLAST192

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q96E66

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q96E66

PeptideAtlas

More...
PeptideAtlasi
Q96E66

PRoteomics IDEntifications database

More...
PRIDEi
Q96E66

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
76377 [Q96E66-1]
76378 [Q96E66-2]
76379 [Q96E66-3]
76380 [Q96E66-4]
76381 [Q96E66-5]
76382 [Q96E66-6]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q96E66

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q96E66

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000184154 Expressed in testis and 121 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q96E66 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q96E66 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000184154 Tissue enhanced (fallopian tube, testis)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
128624, 2 interactors

Protein interaction database and analysis system

More...
IntActi
Q96E66, 1 interactor

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati49 – 71LRR 1Add BLAST23
Repeati80 – 101LRR 2Add BLAST22
Repeati103 – 124LRR 3Add BLAST22
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini137 – 175LRRCTAdd BLAST39

Keywords - Domaini

Leucine-rich repeat, Repeat

Phylogenomic databases

Ensembl GeneTree

More...
GeneTreei
ENSGT00510000047925
ENSGT00940000161220

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_095080_1_1_1

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q96E66

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
3.80.10.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR001611 Leu-rich_rpt
IPR032675 LRR_dom_sf
IPR043196 LRTOMT1

The PANTHER Classification System

More...
PANTHERi
PTHR46545 PTHR46545, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS51450 LRR, 4 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (6+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 6 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 6 described isoforms and 5 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q96E66-1) [UniParc]FASTAAdd to basket
Also known as: A

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MNKRDYMNTS VQEPPLDYSF RSIHVIQDLV NEEPRTGLRP LKRSKSGKSL
60 70 80 90 100
TQSLWLNNNV LNDLRDFNQV ASQLLEHPEN LAWIDLSFND LTSIDPVLTT
110 120 130 140 150
FFNLSVLYLH GNSIQRLGEV NKLAVLPRLR SLTLHGNPME EEKGYRQYVL
160 170 180 190
CTLSRITTFD FSGVTKADRT TAEVWKRMNI KPKKAWTKQN TL
Length:192
Mass (Da):22,206
Last modified:December 1, 2001 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iFABF76A0C1F53A67
GO
Isoform 2 (identifier: Q96E66-2) [UniParc]FASTAAdd to basket
Also known as: B

The sequence of this isoform differs from the canonical sequence as follows:
     147-192: QYVLCTLSRITTFDFSGVTKADRTTAEVWKRMNIKPKKAWTKQNTL → VPGSVEMPHRPP

Show »
Length:158
Mass (Da):18,132
Checksum:i6AC861EC2136838F
GO
Isoform 3 (identifier: Q96E66-3) [UniParc]FASTAAdd to basket
Also known as: C

The sequence of this isoform differs from the canonical sequence as follows:
     147-192: Missing.

Show »
Length:146
Mass (Da):16,847
Checksum:i8771D5BEABC3F9D4
GO
Isoform 4 (identifier: Q96E66-4) [UniParc]FASTAAdd to basket
Also known as: D

The sequence of this isoform differs from the canonical sequence as follows:
     146-192: RQYVLCTLSR...KKAWTKQNTL → SRPWTPRPVL...QLRAHPCPAR

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.Curated
Show »
Length:227
Mass (Da):24,914
Checksum:i70FB60750230B106
GO
Isoform 5 (identifier: Q96E66-5) [UniParc]FASTAAdd to basket
Also known as: E

The sequence of this isoform differs from the canonical sequence as follows:
     146-192: RQYVLCTLSR...KKAWTKQNTL → SRPWTPRPVL...QLRAHPCPAR

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.Curated
Show »
Length:187
Mass (Da):21,180
Checksum:i54C4AD20E1AF207C
GO
Isoform 6 (identifier: Q96E66-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-27: MNKRDYMNTSVQEPPLDYSFRSIHVIQ → MVEFQPSVT

Show »
Length:174
Mass (Da):19,974
Checksum:iE54E485D62E670E9
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 5 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
Q8WZ04TOMT_HUMAN
Transmembrane O-methyltransferase
LRTOMT COMT2, TOMT, PP7517
291Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F5GYI0F5GYI0_HUMAN
Leucine-rich repeat-containing prot...
LRTOMT
103Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F5H6F7F5H6F7_HUMAN
Leucine-rich repeat-containing prot...
LRTOMT
54Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F5H614F5H614_HUMAN
Leucine-rich repeat-containing prot...
LRTOMT
65Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F5H6K5F5H6K5_HUMAN
Leucine-rich repeat-containing prot...
LRTOMT
38Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti12Q → R in BAG35968 (PubMed:14702039).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0418521 – 27MNKRD…IHVIQ → MVEFQPSVT in isoform 6. 1 PublicationAdd BLAST27
Alternative sequenceiVSP_036893146 – 192RQYVL…KQNTL → SRPWTPRPVLCSGPPAQGPG RDHVPCHCIGLPATGGNIAG AVPALLPIAGAHGLAAKPPR LPVRAADRGAGLQLRAHPCP AR in isoform 4. 1 PublicationAdd BLAST47
Alternative sequenceiVSP_036894146 – 192RQYVL…KQNTL → SRPWTPRPVLCSGPPAQPPR LPVRAADRGAGLQLRAHPCP AR in isoform 5. 1 PublicationAdd BLAST47
Alternative sequenceiVSP_036895147 – 192QYVLC…KQNTL → VPGSVEMPHRPP in isoform 2. 1 PublicationAdd BLAST46
Alternative sequenceiVSP_036896147 – 192Missing in isoform 3. 1 PublicationAdd BLAST46

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
EU627066 mRNA Translation: ACF40876.1
EU627067 mRNA Translation: ACF40877.1
EU627068 mRNA Translation: ACF40878.1
EU627069 mRNA Translation: ACF40879.1
EU627070 mRNA Translation: ACF40880.1
AK298997 mRNA Translation: BAH12920.1
AK313150 mRNA Translation: BAG35968.1
AP000812 Genomic DNA No translation available.
AP002490 Genomic DNA No translation available.
CH471076 Genomic DNA Translation: EAW74832.1
BC012855 mRNA Translation: AAH12855.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS44667.1 [Q96E66-2]
CCDS55778.1 [Q96E66-6]
CCDS59227.1 [Q96E66-3]
CCDS8208.1 [Q96E66-1]

NCBI Reference Sequences

More...
RefSeqi
NP_001138779.1, NM_001145307.4 [Q96E66-2]
NP_001192067.1, NM_001205138.3 [Q96E66-6]
NP_001258400.1, NM_001271471.2 [Q96E66-3]
NP_001305732.1, NM_001318803.1 [Q96E66-1]
NP_660352.1, NM_145309.5 [Q96E66-1]
XP_006718536.1, XM_006718473.3 [Q96E66-1]
XP_006718537.1, XM_006718474.3 [Q96E66-1]
XP_011543149.1, XM_011544847.2 [Q96E66-1]
XP_011543150.1, XM_011544848.2 [Q96E66-1]
XP_016872848.1, XM_017017359.1
XP_016872849.1, XM_017017360.1

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000289488; ENSP00000289488; ENSG00000184154 [Q96E66-1]
ENST00000324866; ENSP00000440693; ENSG00000184154 [Q96E66-3]
ENST00000423494; ENSP00000441249; ENSG00000184154 [Q96E66-6]
ENST00000447974; ENSP00000414271; ENSG00000184154 [Q96E66-1]
ENST00000536917; ENSP00000443421; ENSG00000184154 [Q96E66-3]
ENST00000538413; ENSP00000438762; ENSG00000184154 [Q96E66-1]
ENST00000538478; ENSP00000444583; ENSG00000184154 [Q96E66-1]
ENST00000541614; ENSP00000438522; ENSG00000184154 [Q96E66-2]
ENST00000615940; ENSP00000482923; ENSG00000184154 [Q96E66-6]
ENST00000642648; ENSP00000494362; ENSG00000184154 [Q96E66-1]
ENST00000647530; ENSP00000494072; ENSG00000184154 [Q96E66-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
220074

UCSC genome browser

More...
UCSCi
uc001orr.4 human [Q96E66-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
EU627066 mRNA Translation: ACF40876.1
EU627067 mRNA Translation: ACF40877.1
EU627068 mRNA Translation: ACF40878.1
EU627069 mRNA Translation: ACF40879.1
EU627070 mRNA Translation: ACF40880.1
AK298997 mRNA Translation: BAH12920.1
AK313150 mRNA Translation: BAG35968.1
AP000812 Genomic DNA No translation available.
AP002490 Genomic DNA No translation available.
CH471076 Genomic DNA Translation: EAW74832.1
BC012855 mRNA Translation: AAH12855.1
CCDSiCCDS44667.1 [Q96E66-2]
CCDS55778.1 [Q96E66-6]
CCDS59227.1 [Q96E66-3]
CCDS8208.1 [Q96E66-1]
RefSeqiNP_001138779.1, NM_001145307.4 [Q96E66-2]
NP_001192067.1, NM_001205138.3 [Q96E66-6]
NP_001258400.1, NM_001271471.2 [Q96E66-3]
NP_001305732.1, NM_001318803.1 [Q96E66-1]
NP_660352.1, NM_145309.5 [Q96E66-1]
XP_006718536.1, XM_006718473.3 [Q96E66-1]
XP_006718537.1, XM_006718474.3 [Q96E66-1]
XP_011543149.1, XM_011544847.2 [Q96E66-1]
XP_011543150.1, XM_011544848.2 [Q96E66-1]
XP_016872848.1, XM_017017359.1
XP_016872849.1, XM_017017360.1

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

BioGRIDi128624, 2 interactors
IntActiQ96E66, 1 interactor

PTM databases

iPTMnetiQ96E66
PhosphoSitePlusiQ96E66

Polymorphism and mutation databases

BioMutaiLRTOMT
DMDMi74760801

Proteomic databases

EPDiQ96E66
MassIVEiQ96E66
PeptideAtlasiQ96E66
PRIDEiQ96E66
ProteomicsDBi76377 [Q96E66-1]
76378 [Q96E66-2]
76379 [Q96E66-3]
76380 [Q96E66-4]
76381 [Q96E66-5]
76382 [Q96E66-6]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
34978 55 antibodies

The DNASU plasmid repository

More...
DNASUi
220074

Genome annotation databases

EnsembliENST00000289488; ENSP00000289488; ENSG00000184154 [Q96E66-1]
ENST00000324866; ENSP00000440693; ENSG00000184154 [Q96E66-3]
ENST00000423494; ENSP00000441249; ENSG00000184154 [Q96E66-6]
ENST00000447974; ENSP00000414271; ENSG00000184154 [Q96E66-1]
ENST00000536917; ENSP00000443421; ENSG00000184154 [Q96E66-3]
ENST00000538413; ENSP00000438762; ENSG00000184154 [Q96E66-1]
ENST00000538478; ENSP00000444583; ENSG00000184154 [Q96E66-1]
ENST00000541614; ENSP00000438522; ENSG00000184154 [Q96E66-2]
ENST00000615940; ENSP00000482923; ENSG00000184154 [Q96E66-6]
ENST00000642648; ENSP00000494362; ENSG00000184154 [Q96E66-1]
ENST00000647530; ENSP00000494072; ENSG00000184154 [Q96E66-1]
GeneIDi220074
UCSCiuc001orr.4 human [Q96E66-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
220074
DisGeNETi220074
EuPathDBiHostDB:ENSG00000184154.12

GeneCards: human genes, protein and diseases

More...
GeneCardsi
LRTOMT
GeneReviewsiLRTOMT
HGNCiHGNC:25033 LRTOMT
HPAiENSG00000184154 Tissue enhanced (fallopian tube, testis)
MalaCardsiLRTOMT
MIMi612414 gene
neXtProtiNX_Q96E66
OpenTargetsiENSG00000184154
PharmGKBiPA164722133

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

GeneTreeiENSGT00510000047925
ENSGT00940000161220
HOGENOMiCLU_095080_1_1_1
PhylomeDBiQ96E66

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
220074 0 hits in 784 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
LRTOMT human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
220074
PharosiQ96E66 Tbio

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000184154 Expressed in testis and 121 other tissues
ExpressionAtlasiQ96E66 baseline and differential
GenevisibleiQ96E66 HS

Family and domain databases

Gene3Di3.80.10.10, 1 hit
InterProiView protein in InterPro
IPR001611 Leu-rich_rpt
IPR032675 LRR_dom_sf
IPR043196 LRTOMT1
PANTHERiPTHR46545 PTHR46545, 1 hit
PROSITEiView protein in PROSITE
PS51450 LRR, 4 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiLRC51_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q96E66
Secondary accession number(s): B2R7X1
, B6CZ35, B6CZ36, B6CZ37, B6CZ38, B6CZ39, B7Z5I4
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: March 7, 2006
Last sequence update: December 1, 2001
Last modified: June 17, 2020
This is version 144 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human chromosome 11
    Human chromosome 11: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again