RMI2

Functionⁱ

Essential component of the RMI complex, a complex that plays an important role in the processing of homologous recombination intermediates. It is required to regulate sister chromatid segregation and to limit DNA crossover. Essential for the stability, localization, and function of BLM, TOP3A, and complexes containing BLM. In the RMI complex, it is required to target BLM to chromatin and stress-induced nuclear foci and mitotic phosphorylation of BLM.3 Publications

Regions

Feature key	Position(s)	DescriptionActions	Graphical view	Length
DNA bindingⁱ	44 – 114	OBAdd BLAST		71

GO - Molecular functionⁱ

DNA binding Source: UniProtKB-KW

View the complete GO annotation on QuickGO ...

GO - Biological processⁱ

DNA replication Source: Reactome
regulation of sister chromatid segregation
Source: UniProtKB
Inferred from mutant phenotypeⁱ
- 27977684

View the complete GO annotation on QuickGO ...

Keywordsⁱ

Molecular function	DNA-binding
Biological process	DNA replication

Enzyme and pathway databases

Reactomeⁱ	R-HSA-5685938 HDR through Single Strand Annealing (SSA) R-HSA-5685942 HDR through Homologous Recombination (HRR) R-HSA-5693554 Resolution of D-loop Structures through Synthesis-Dependent Strand Annealing (SDSA) R-HSA-5693568 Resolution of D-loop Structures through Holliday Junction Intermediates R-HSA-5693579 Homologous DNA Pairing and Strand Exchange R-HSA-5693607 Processing of DNA double-strand break ends R-HSA-5693616 Presynaptic phase of homologous DNA pairing and strand exchange R-HSA-6804756 Regulation of TP53 Activity through Phosphorylation R-HSA-69473 G2/M DNA damage checkpoint

Reactomeⁱ

R-HSA-5685938 HDR through Single Strand Annealing (SSA)
R-HSA-5685942 HDR through Homologous Recombination (HRR)
R-HSA-5693554 Resolution of D-loop Structures through Synthesis-Dependent Strand Annealing (SDSA)
R-HSA-5693568 Resolution of D-loop Structures through Holliday Junction Intermediates
R-HSA-5693579 Homologous DNA Pairing and Strand Exchange
R-HSA-5693607 Processing of DNA double-strand break ends
R-HSA-5693616 Presynaptic phase of homologous DNA pairing and strand exchange
R-HSA-6804756 Regulation of TP53 Activity through Phosphorylation
R-HSA-69473 G2/M DNA damage checkpoint

Names & Taxonomyⁱ

Protein namesⁱ	Recommended name: RecQ-mediated genome instability protein 2 Short name: hRMI2 Alternative name(s): BLM-associated protein of 18 kDa Short name: BLAP18
Gene namesⁱ	Name:RMI2 Synonyms:C16orf75
Organismⁱ	Homo sapiens (Human)
Taxonomic identifierⁱ	9606 [NCBI]
Taxonomic lineageⁱ	cellular organisms › Eukaryota › Opisthokonta › Metazoa › Eumetazoa › Bilateria › Deuterostomia › Chordata › Craniata › Vertebrata › Gnathostomata › Teleostomi › Euteleostomi › Sarcopterygii › Dipnotetrapodomorpha › Tetrapoda › Amniota › Mammalia › Theria › Eutheria › Boreoeutheria › Euarchontoglires › Primates › Haplorrhini › Simiiformes › Catarrhini › Hominoidea › Hominidae › Homininae › Homo
Proteomesⁱ	UP000005640 Componentⁱ: Chromosome 16

Organism-specific databases

EuPathDBⁱ	HostDB:ENSG00000175643.8
Human Gene Nomenclature Database More...HGNCⁱ	HGNC:28349 RMI2
MIMⁱ	612426 gene
neXtProtⁱ	NX_Q96E14

Keywords - Cellular componentⁱ

Nucleus

Pathology & Biotechⁱ

Involvement in diseaseⁱ

A homozygous deletion of RMI2 has been found in a family with a Bloom-like syndrome and is probable responsible for the phenotype. Patients manifest depigmented skin lesions, multiple cafe-au-lait macules, and growth deficiency. Cells from affected individuals show a high rate of sister chromatid exchange and increased chromosomal breaks.1 Publication

Mutagenesis

Feature key	Position(s)	DescriptionActions	Length
Mutagenesisⁱ	24	K → A: Abolishes interaction with RMI1, TOP3A and BLM. 1 Publication	1
Mutagenesisⁱ	59	W → A: According to PubMed:18923083, abolishes interaction with RMI1, TOP3A and BLM. According to PubMed:18923082, does not affects interaction with RMI1 and TOP3A. 1 Publication	1
Mutagenesisⁱ	100	K → A: Does not affect interaction with RMI1, TOP3A and BLM. 1 Publication	1
Mutagenesisⁱ	121	K → A: According to PubMed:18923083, does not affect interaction with RMI1, TOP3A and BLM. According to PubMed:18923082, affects interaction with BLM and the BMI complex. 2 Publications	1
Mutagenesisⁱ	135	W → A: Abolishes interaction with RMI1, TOP3A and BLM. 1 Publication	1

Organism-specific databases

DisGeNET More...DisGeNETⁱ	116028
Open Targets More...OpenTargetsⁱ	ENSG00000175643
PharmGKBⁱ	PA145149635

Polymorphism and mutation databases

BioMutaⁱ	RMI2
DMDMⁱ	74731517

PTM / Processingⁱ

Molecule processing

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Initiator methionineⁱ		RemovedCombined sources
ChainⁱPRO_0000297577	2 – 147	RecQ-mediated genome instability protein 2Add BLAST		146

Amino acid modifications

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Modified residueⁱ	2	N-acetylalanineCombined sources		1
Modified residueⁱ	7	PhosphoserineCombined sources		1

Post-translational modificationⁱ

Phosphorylated during mitosis.1 Publication

Keywords - PTMⁱ

Acetylation, Phosphoprotein

Proteomic databases

EPDⁱ	Q96E14
MaxQB - The MaxQuant DataBase More...MaxQBⁱ	Q96E14
PaxDbⁱ	Q96E14
PeptideAtlas More...PeptideAtlasⁱ	Q96E14
PRIDEⁱ	Q96E14
ProteomicsDBⁱ	76362 76363 [Q96E14-2]

PTM databases

iPTMnetⁱ	Q96E14
PhosphoSitePlusⁱ	Q96E14

Expressionⁱ

Gene expression databases

Bgeeⁱ	ENSG00000175643
CleanExⁱ	HS_C16orf75
ExpressionAtlasⁱ	Q96E14 baseline and differential
Genevisibleⁱ	Q96E14 HS

Organism-specific databases

Human Protein Atlas More...HPAⁱ	HPA040995

HPAⁱ

HPA040995

Interactionⁱ

Subunit structureⁱ

Component of the RMI complex, containing at least TOP3A, RMI1 and RMI2. The RMI complex interacts with BLM.2 Publications

Binary interactionsⁱ

With	Entry	#Exp.	IntAct	Notes
RMI1	Q9H9A7	13	EBI-15876491,EBI-621339

With

Entry

#Exp.

IntAct

Notes

RMI1

Q9H9A7

13

EBI-15876491,EBI-621339

Protein-protein interaction databases

BioGridⁱ	125466, 15 interactors
ComplexPortalⁱ	CPX-3301 BTR double Holliday Junction dissolution complex
Database of interacting proteins More...DIPⁱ	DIP-56480N
IntActⁱ	Q96E14, 8 interactors
Molecular INTeraction database More...MINTⁱ	Q96E14
STRINGⁱ	9606.ENSP00000310356

Structureⁱ

Secondary structure

Legend: HelixTurnBeta strandPDB Structure known for this area

Show more details

Feature key	Position(s)	DescriptionActions	Length
Helixⁱ	27 – 33	Combined sources	7
Beta strandⁱ	34 – 36	Combined sources	3
Beta strandⁱ	40 – 43	Combined sources	4
Turnⁱ	46 – 49	Combined sources	4
Beta strandⁱ	56 – 68	Combined sources	13
Beta strandⁱ	71 – 76	Combined sources	6
Beta strandⁱ	79 – 84	Combined sources	6
Helixⁱ	86 – 88	Combined sources	3
Beta strandⁱ	92 – 94	Combined sources	3
Beta strandⁱ	101 – 110	Combined sources	10
Beta strandⁱ	112 – 114	Combined sources	3
Beta strandⁱ	116 – 124	Combined sources	9
Helixⁱ	130 – 143	Combined sources	14

3D structure databases

ProteinModelPortalⁱ	Q96E14
SMRⁱ	Q96E14
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Family & Domainsⁱ

Sequence similaritiesⁱ

Belongs to the RMI2 family.Curated

Phylogenomic databases

eggNOGⁱ	ENOG410IXR6 Eukaryota ENOG41120UE LUCA
Ensembl GeneTree More...GeneTreeⁱ	ENSGT00390000001653
HOGENOMⁱ	HOG000154149
HOVERGENⁱ	HBG108410
InParanoidⁱ	Q96E14
KEGG Orthology (KO) More...KOⁱ	K15365
OMAⁱ	AAVWMQG
Database of Orthologous Groups More...OrthoDBⁱ	EOG091G0SYG
PhylomeDBⁱ	Q96E14
TreeFamⁱ	TF332971

Family and domain databases

InterProⁱ	View protein in InterPro IPR032245 RMI2
PANTHERⁱ	PTHR33962 PTHR33962, 1 hit
Pfam protein domain database More...Pfamⁱ	View protein in Pfam PF16100 RMI2, 1 hit

Sequences (2)ⁱ

Sequence statusⁱ: Complete.

Sequence processingⁱ: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsⁱ produced by alternative splicing. Align Add to basket Added to basket

Isoform 1 (identifier: Q96E14-1) [UniParc]FASTA Add to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAAAADSFSG GPAGVRLPRS PPLKVLAEQL RRDAEGGPGA WRLSRAAAGR 
        60         70         80         90        100
GPLDLAAVWM QGRVVMADRG EARLRDPSGD FSVRGLERVP RGRPCLVPGK 
       110        120        130        140 
YVMVMGVVQA CSPEPCLQAV KMTDLSDNPI HESMWELEVE DLHRNIP

Length:147

Mass (Da):15,865

Last modified:March 1, 2004 - v2

Checksum:ⁱC385825F9AB4439E

GO

Isoform 2 (identifier: Q96E14-2) [UniParc]FASTA Add to basket

The sequence of this isoform differs from the canonical sequence as follows:
1-98: MAAAADSFSG...VPRGRPCLVP → MKQTQVGSLFSLGIRNPEPGPVSGTAVPRQLAWKS

« Hide

        10         20         30         40         50
MKQTQVGSLF SLGIRNPEPG PVSGTAVPRQ LAWKSGKYVM VMGVVQACSP 
        60         70         80 
EPCLQAVKMT DLSDNPIHES MWELEVEDLH RNIP

Note: No experimental confirmation available.

Show »

Length:84

Mass (Da):9,262

Checksum:ⁱDAFD4A80EF28023B

GO

Alternative sequence

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Alternative sequenceⁱVSP_027287	1 – 98	MAAAA…PCLVP → MKQTQVGSLFSLGIRNPEPG PVSGTAVPRQLAWKS in isoform 2. 1 PublicationAdd BLAST		98

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	AK123764 mRNA Translation: BAG53958.1 AC009121 Genomic DNA No translation available. CH471112 Genomic DNA Translation: EAW85155.1 BC013040 mRNA Translation: AAH13040.2 BC022427 mRNA Translation: AAH22427.1 BC031016 mRNA Translation: AAH31016.1 BC039361 mRNA Translation: AAH39361.1
The Consensus CDS (CCDS) project More...CCDSⁱ	CCDS10548.1 [Q96E14-1]
NCBI Reference Sequences More...RefSeqⁱ	NP_689521.1, NM_152308.2 [Q96E14-1]
UniGeneⁱ	Hs.347524

Genome annotation databases

Ensemblⁱ	ENST00000312499; ENSP00000310356; ENSG00000175643 [Q96E14-1] ENST00000572173; ENSP00000461206; ENSG00000175643 [Q96E14-2]
GeneIDⁱ	116028
KEGGⁱ	hsa:116028
UCSC genome browser More...UCSCⁱ	uc002daw.2 human [Q96E14-1]

Keywords - Coding sequence diversityⁱ

Alternative splicing

Similar proteinsⁱ

100% Identity
90% Identity
50% Identity

Protein	Similar proteins		Species	Score	Length
Q96E14	Chromosome 16 open reading frame 75		PANTR		147
UPI0001E24E57		HUMAN		150

Protein	Similar proteins		Species	Score	Length
Q96E14	Chromosome 16 open reading frame 75		PANTR		147
UPI0001E24E57		HUMAN		150
RecQ mediated genome instability 2		RHIBE		150
Uncharacterized protein		PONAB		147
RecQ mediated genome instability 2		CERAT		147
+10
Q96E14-2	RMI2 isoform 2		PANTR		84
RecQ mediated genome instability 2		PANPA		84
Uncharacterized protein		PONAB		84
RecQ mediated genome instability 2		GORGO		84
Uncharacterized protein		COLAP		83
+10

Protein	Similar proteins		Species	Score	Length
Q96E14	Chromosome 16 open reading frame 75		PANTR		147
UPI0001E24E57		HUMAN		150
RecQ mediated genome instability 2		RHIBE		150
RecQ mediated genome instability 2		GORGO		147
RecQ mediated genome instability 2		PAPAN		147
+16
Q96E14-2	RecQ mediated genome instability 2		GORGO		84
RMI2 isoform 2		PANTR		84
RecQ mediated genome instability 2		PANPA		84
Uncharacterized protein		PONAB		84
Uncharacterized protein		COLAP		83
+25

Cross-referencesⁱ

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	AK123764 mRNA Translation: BAG53958.1 AC009121 Genomic DNA No translation available. CH471112 Genomic DNA Translation: EAW85155.1 BC013040 mRNA Translation: AAH13040.2 BC022427 mRNA Translation: AAH22427.1 BC031016 mRNA Translation: AAH31016.1 BC039361 mRNA Translation: AAH39361.1
The Consensus CDS (CCDS) project More...CCDSⁱ	CCDS10548.1 [Q96E14-1]
NCBI Reference Sequences More...RefSeqⁱ	NP_689521.1, NM_152308.2 [Q96E14-1]
UniGeneⁱ	Hs.347524

3D structure databases

Select the link destinations: Protein Data Bank Europe More...PDBeⁱ Protein Data Bank RCSB More...RCSB PDBⁱ Protein Data Bank Japan More...PDBjⁱ Links Updated	PDB entry	Method	Resolution (Å)	Chain	Positions	PDBsum
	3MXN	X-ray	1.55	B	1-147	[»]
	3NBH	X-ray	2.00	B	6-147	[»]
	4DAY	X-ray	3.30	B	1-147	[»]
ProteinModelPortalⁱ	Q96E14
SMRⁱ	Q96E14
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Protein-protein interaction databases

BioGridⁱ	125466, 15 interactors
ComplexPortalⁱ	CPX-3301 BTR double Holliday Junction dissolution complex
Database of interacting proteins More...DIPⁱ	DIP-56480N
IntActⁱ	Q96E14, 8 interactors
Molecular INTeraction database More...MINTⁱ	Q96E14
STRINGⁱ	9606.ENSP00000310356

PTM databases

iPTMnetⁱ	Q96E14
PhosphoSitePlusⁱ	Q96E14

Polymorphism and mutation databases

BioMutaⁱ	RMI2
DMDMⁱ	74731517

Proteomic databases

EPDⁱ	Q96E14
MaxQB - The MaxQuant DataBase More...MaxQBⁱ	Q96E14
PaxDbⁱ	Q96E14
PeptideAtlas More...PeptideAtlasⁱ	Q96E14
PRIDEⁱ	Q96E14
ProteomicsDBⁱ	76362 76363 [Q96E14-2]

Protocols and materials databases

Structural Biology Knowledgebase	Search...

Structural Biology Knowledgebase

Search...

Genome annotation databases

Ensemblⁱ	ENST00000312499; ENSP00000310356; ENSG00000175643 [Q96E14-1] ENST00000572173; ENSP00000461206; ENSG00000175643 [Q96E14-2]
GeneIDⁱ	116028
KEGGⁱ	hsa:116028
UCSC genome browser More...UCSCⁱ	uc002daw.2 human [Q96E14-1]

Organism-specific databases

CTDⁱ	116028
DisGeNET More...DisGeNETⁱ	116028
EuPathDBⁱ	HostDB:ENSG00000175643.8
GeneCardsⁱ	RMI2
H-InvDBⁱ	HIX0012817
Human Gene Nomenclature Database More...HGNCⁱ	HGNC:28349 RMI2
Human Protein Atlas More...HPAⁱ	HPA040995
MIMⁱ	612426 gene
neXtProtⁱ	NX_Q96E14
Open Targets More...OpenTargetsⁱ	ENSG00000175643
PharmGKBⁱ	PA145149635
GenAtlas: human gene database More...GenAtlasⁱ	Search...

Phylogenomic databases

eggNOGⁱ	ENOG410IXR6 Eukaryota ENOG41120UE LUCA
Ensembl GeneTree More...GeneTreeⁱ	ENSGT00390000001653
HOGENOMⁱ	HOG000154149
HOVERGENⁱ	HBG108410
InParanoidⁱ	Q96E14
KEGG Orthology (KO) More...KOⁱ	K15365
OMAⁱ	AAVWMQG
Database of Orthologous Groups More...OrthoDBⁱ	EOG091G0SYG
PhylomeDBⁱ	Q96E14
TreeFamⁱ	TF332971

Enzyme and pathway databases

Reactomeⁱ	R-HSA-5685938 HDR through Single Strand Annealing (SSA) R-HSA-5685942 HDR through Homologous Recombination (HRR) R-HSA-5693554 Resolution of D-loop Structures through Synthesis-Dependent Strand Annealing (SDSA) R-HSA-5693568 Resolution of D-loop Structures through Holliday Junction Intermediates R-HSA-5693579 Homologous DNA Pairing and Strand Exchange R-HSA-5693607 Processing of DNA double-strand break ends R-HSA-5693616 Presynaptic phase of homologous DNA pairing and strand exchange R-HSA-6804756 Regulation of TP53 Activity through Phosphorylation R-HSA-69473 G2/M DNA damage checkpoint

Reactomeⁱ

R-HSA-5685938 HDR through Single Strand Annealing (SSA)
R-HSA-5685942 HDR through Homologous Recombination (HRR)
R-HSA-5693554 Resolution of D-loop Structures through Synthesis-Dependent Strand Annealing (SDSA)
R-HSA-5693568 Resolution of D-loop Structures through Holliday Junction Intermediates
R-HSA-5693579 Homologous DNA Pairing and Strand Exchange
R-HSA-5693607 Processing of DNA double-strand break ends
R-HSA-5693616 Presynaptic phase of homologous DNA pairing and strand exchange
R-HSA-6804756 Regulation of TP53 Activity through Phosphorylation
R-HSA-69473 G2/M DNA damage checkpoint

Miscellaneous databases

ChiTaRSⁱ	RMI2 human
GenomeRNAiⁱ	116028
Protein Ontology More...PROⁱ	PR:Q96E14
SOURCEⁱ	Search...

Gene expression databases

Bgeeⁱ	ENSG00000175643
CleanExⁱ	HS_C16orf75
ExpressionAtlasⁱ	Q96E14 baseline and differential
Genevisibleⁱ	Q96E14 HS

Family and domain databases

InterProⁱ	View protein in InterPro IPR032245 RMI2
PANTHERⁱ	PTHR33962 PTHR33962, 1 hit
Pfam protein domain database More...Pfamⁱ	View protein in Pfam PF16100 RMI2, 1 hit
ProtoNetⁱ	Search...

Entry informationⁱ

Entry nameⁱ	RMI2_HUMAN
Accessionⁱ	Q96E14Primary (citable) accession number: Q96E14 Secondary accession number(s): B3KVZ6, Q49AE2, Q8TBL0
Entry historyⁱ	Integrated into UniProtKB/Swiss-Prot:	August 21, 2007
	Last sequence update:	March 1, 2004
	Last modified:	June 20, 2018
	This is version 119 of the entry and version 2 of the sequence. See complete history.
Entry statusⁱ	Reviewed (UniProtKB/Swiss-Prot)
Annotation program	Chordata Protein Annotation Program
Disclaimer	Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousⁱ

Keywords - Technical termⁱ

3D-structure, Complete proteome, Reference proteome

Documents

Human chromosome 16
Human chromosome 16: entries, gene names and cross-references to MIM
MIM cross-references
Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
PDB cross-references
Index of Protein Data Bank (PDB) cross-references
SIMILARITY comments
Index of protein domains and families

UniProtKB

UniParc

Help

UniRef

Proteomes

Annotation systems

Supporting data

UniProtKB - Q96E14 (RMI2_HUMAN)

Your basket is currently empty. i <p>When browsing through different UniProt proteins, you can use the ‘basket’ to save them, so that you can back to find or analyse them later.<p><a href='/help/basket' target='_top'>More...</a></p>

RecQ-mediated genome instability protein 2

Select a section on the left to see content.

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Regions

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Biological processi

Enzyme and pathway databases

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

Organism-specific databases

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Nucleus

Cytosol

Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Organism-specific databases

Polymorphism and mutation databases

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Amino acid modifications

Proteomic databases

PTM databases

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Organism-specific databases

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

3D structure databases

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Phylogenomic databases

Family and domain databases

Alternative sequence

Sequence databases

Genome annotation databases

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

3D structure databases

Protein-protein interaction databases

PTM databases

Polymorphism and mutation databases

Proteomic databases

Protocols and materials databases

Genome annotation databases

Organism-specific databases

Phylogenomic databases

Enzyme and pathway databases

Miscellaneous databases

Gene expression databases

Family and domain databases

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Documents

UniProt is an ELIXIR core data resource

Your basket is currently empty. ⁱ

Functionⁱ

GO - Molecular functionⁱ

GO - Biological processⁱ

Names & Taxonomyⁱ

Subcellular locationⁱ

Pathology & Biotechⁱ

PTM / Processingⁱ

Expressionⁱ

Interactionⁱ

Structureⁱ

Family & Domainsⁱ

Sequence similaritiesⁱ

Cross-referencesⁱ

Entry informationⁱ

Miscellaneousⁱ