Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 164 (26 Feb 2020)
Sequence version 1 (01 Dec 2001)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Ankyrin repeat and SOCS box protein 9

Gene

ASB9

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Substrate-recognition component of a SCF-like ECS (Elongin-Cullin-SOCS-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. Recognizes at least two forms of creatine kinase, CKB and CKMT1A.1 Publication

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section describes the metabolic pathway(s) associated with a protein.<p><a href='/help/pathway' target='_top'>More...</a></p>Pathwayi: protein ubiquitination

This protein is involved in the pathway protein ubiquitination, which is part of Protein modification.
View all proteins of this organism that are known to be involved in the pathway protein ubiquitination and in Protein modification.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection describes interesting single amino acid sites on the sequence that are not defined in any other subsection. This subsection can be displayed in different sections ('Function', 'PTM / Processing', 'Pathology and Biotech') according to its content.<p><a href='/help/site' target='_top'>More...</a></p>Sitei103Essential for binding to CKB1
Sitei107Essential for binding to CKB1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processUbl conjugation pathway

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-8951664 Neddylation
R-HSA-983168 Antigen processing: Ubiquitination & Proteasome degradation

UniPathway: a resource for the exploration and annotation of metabolic pathways

More...
UniPathwayi
UPA00143

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Ankyrin repeat and SOCS box protein 9
Short name:
ASB-9
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:ASB9
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome X

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:17184 ASB9

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
300890 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q96DX5

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Mitochondrion

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

Open Targets

More...
OpenTargetsi
ENSG00000102048

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA25037

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q96DX5 Tbio

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
ASB9

Domain mapping of disease mutations (DMDM)

More...
DMDMi
29839756

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000669401 – 294Ankyrin repeat and SOCS box protein 9Add BLAST294

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei1N-acetylmethionineCombined sources1
Modified residuei51PhosphoserineCombined sources1

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q96DX5

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q96DX5

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q96DX5

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q96DX5

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q96DX5

PeptideAtlas

More...
PeptideAtlasi
Q96DX5

PRoteomics IDEntifications database

More...
PRIDEi
Q96DX5

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
76334 [Q96DX5-1]
76335 [Q96DX5-2]
76336 [Q96DX5-3]

2D gel databases

REPRODUCTION-2DPAGE

More...
REPRODUCTION-2DPAGEi
IPI00179183

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q96DX5

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q96DX5

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Predominantly expressed in testis, kidney, and liver.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000102048 Expressed in right testis and 120 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q96DX5 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q96DX5 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
CAB004997
HPA003014
HPA003060

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Show more details

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
126615, 36 interactors

CORUM comprehensive resource of mammalian protein complexes

More...
CORUMi
Q96DX5

Database of interacting proteins

More...
DIPi
DIP-52905N

Protein interaction database and analysis system

More...
IntActi
Q96DX5, 17 interactors

Molecular INTeraction database

More...
MINTi
Q96DX5

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000369855

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q96DX5 protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1294
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q96DX5

Database of comparative protein structure models

More...
ModBasei
Search...

Protein Data Bank in Europe - Knowledge Base

More...
PDBe-KBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
Q96DX5

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati35 – 64ANK 1Add BLAST30
Repeati68 – 97ANK 2Add BLAST30
Repeati101 – 130ANK 3Add BLAST30
Repeati133 – 162ANK 4Add BLAST30
Repeati166 – 195ANK 5Add BLAST30
Repeati198 – 227ANK 6Add BLAST30
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini240 – 294SOCS boxPROSITE-ProRule annotationAdd BLAST55

<p>This subsection of the 'Family and domains' section provides general information on the biological role of a domain. The term 'domain' is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The SOCS box domain mediates the interaction with the Elongin BC complex, an adapter module in different E3 ubiquitin-protein ligase complexes.By similarity

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the ankyrin SOCS box (ASB) family.Curated

Keywords - Domaini

ANK repeat, Repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG0504 Eukaryota
COG0666 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000157160

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_000134_4_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q96DX5

KEGG Orthology (KO)

More...
KOi
K10331

Identification of Orthologs from Complete Genome Data

More...
OMAi
HVTCVSL

Database of Orthologous Groups

More...
OrthoDBi
1546307at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q96DX5

TreeFam database of animal gene trees

More...
TreeFami
TF331945

Family and domain databases

Conserved Domains Database

More...
CDDi
cd03728 SOCS_ASB_9_11, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.25.40.20, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR002110 Ankyrin_rpt
IPR020683 Ankyrin_rpt-contain_dom
IPR036770 Ankyrin_rpt-contain_sf
IPR037333 ASB9/11_SOCS
IPR001496 SOCS_box
IPR036036 SOCS_box-like_dom_sf

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF12796 Ank_2, 2 hits
PF07525 SOCS_box, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00248 ANK, 6 hits
SM00969 SOCS_box, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF158235 SSF158235, 1 hit
SSF48403 SSF48403, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50297 ANK_REP_REGION, 1 hit
PS50088 ANK_REPEAT, 5 hits
PS50225 SOCS, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q96DX5-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MDGKQGGMDG SKPAGPRDFP GIRLLSNPLM GDAVSDWSPM HEAAIHGHQL
60 70 80 90 100
SLRNLISQGW AVNIITADHV SPLHEACLGG HLSCVKILLK HGAQVNGVTA
110 120 130 140 150
DWHTPLFNAC VSGSWDCVNL LLQHGASVQP ESDLASPIHE AARRGHVECV
160 170 180 190 200
NSLIAYGGNI DHKISHLGTP LYLACENQQR ACVKKLLESG ADVNQGKGQD
210 220 230 240 250
SPLHAVARTA SEELACLLMD FGADTQAKNA EGKRPVELVP PESPLAQLFL
260 270 280 290
EREGPPSLMQ LCRLRIRKCF GIQQHHKITK LVLPEDLKQF LLHL
Length:294
Mass (Da):31,858
Last modified:December 1, 2001 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iA1784DCFC294D85A
GO
Isoform 2 (identifier: Q96DX5-2) [UniParc]FASTAAdd to basket
Also known as: ASB9deltaSOCS

The sequence of this isoform differs from the canonical sequence as follows:
     255-294: PPSLMQLCRLRIRKCFGIQQHHKITKLVLPEDLKQFLLHL → ASLPKPKP

Note: Does not interact with the Elongin BC complex, likely to be a negative regulator of isoform 1.Curated
Show »
Length:262
Mass (Da):27,902
Checksum:i9354CAD758EC399F
GO
Isoform 3 (identifier: Q96DX5-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     145-154: Missing.
     255-294: PPSLMQLCRLRIRKCFGIQQHHKITKLVLPEDLKQFLLHL → ASLPKPKP

Show »
Length:252
Mass (Da):26,849
Checksum:i6FEE897C6B1FF98C
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
R4GN94R4GN94_HUMAN
Ankyrin repeat and SOCS box protein...
ASB9
211Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence CAB45706 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti192D → V in CAB45706 (PubMed:17974005).Curated1
Sequence conflicti237E → G in CAB45706 (PubMed:17974005).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_043158145 – 154Missing in isoform 3. 1 Publication10
Alternative sequenceiVSP_000271255 – 294PPSLM…FLLHL → ASLPKPKP in isoform 2 and isoform 3. 3 PublicationsAdd BLAST40

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AK000643 mRNA Translation: BAA91302.1
AK292270 mRNA Translation: BAF84959.1
AL080091 mRNA Translation: CAB45706.2 Different initiation.
CH471074 Genomic DNA Translation: EAW98871.1
CH471074 Genomic DNA Translation: EAW98874.1
BC001244 mRNA Translation: AAH01244.1
BC013172 mRNA Translation: AAH13172.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS14163.1 [Q96DX5-2]
CCDS35208.1 [Q96DX5-1]
CCDS55372.1 [Q96DX5-3]

NCBI Reference Sequences

More...
RefSeqi
NP_001026909.1, NM_001031739.2 [Q96DX5-1]
NP_001162002.1, NM_001168530.1 [Q96DX5-3]
NP_001162003.1, NM_001168531.1 [Q96DX5-2]
NP_076992.1, NM_024087.2 [Q96DX5-2]
XP_005274503.1, XM_005274446.1 [Q96DX5-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000380485; ENSP00000369852; ENSG00000102048 [Q96DX5-2]
ENST00000380488; ENSP00000369855; ENSG00000102048 [Q96DX5-1]
ENST00000380483; ENSP00000369850; ENSG00000102048 [Q96DX5-3]
ENST00000546332; ENSP00000438943; ENSG00000102048 [Q96DX5-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
140462

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:140462

UCSC genome browser

More...
UCSCi
uc004cwk.4 human [Q96DX5-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK000643 mRNA Translation: BAA91302.1
AK292270 mRNA Translation: BAF84959.1
AL080091 mRNA Translation: CAB45706.2 Different initiation.
CH471074 Genomic DNA Translation: EAW98871.1
CH471074 Genomic DNA Translation: EAW98874.1
BC001244 mRNA Translation: AAH01244.1
BC013172 mRNA Translation: AAH13172.1
CCDSiCCDS14163.1 [Q96DX5-2]
CCDS35208.1 [Q96DX5-1]
CCDS55372.1 [Q96DX5-3]
RefSeqiNP_001026909.1, NM_001031739.2 [Q96DX5-1]
NP_001162002.1, NM_001168530.1 [Q96DX5-3]
NP_001162003.1, NM_001168531.1 [Q96DX5-2]
NP_076992.1, NM_024087.2 [Q96DX5-2]
XP_005274503.1, XM_005274446.1 [Q96DX5-1]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
3D9HX-ray2.20A1-258[»]
3ZKJX-ray2.58A/D35-294[»]
3ZNGX-ray2.85A/D35-294[»]
SMRiQ96DX5
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGridi126615, 36 interactors
CORUMiQ96DX5
DIPiDIP-52905N
IntActiQ96DX5, 17 interactors
MINTiQ96DX5
STRINGi9606.ENSP00000369855

PTM databases

iPTMnetiQ96DX5
PhosphoSitePlusiQ96DX5

Polymorphism and mutation databases

BioMutaiASB9
DMDMi29839756

2D gel databases

REPRODUCTION-2DPAGEiIPI00179183

Proteomic databases

EPDiQ96DX5
jPOSTiQ96DX5
MassIVEiQ96DX5
MaxQBiQ96DX5
PaxDbiQ96DX5
PeptideAtlasiQ96DX5
PRIDEiQ96DX5
ProteomicsDBi76334 [Q96DX5-1]
76335 [Q96DX5-2]
76336 [Q96DX5-3]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
140462

Genome annotation databases

EnsembliENST00000380485; ENSP00000369852; ENSG00000102048 [Q96DX5-2]
ENST00000380488; ENSP00000369855; ENSG00000102048 [Q96DX5-1]
ENST00000380483; ENSP00000369850; ENSG00000102048 [Q96DX5-3]
ENST00000546332; ENSP00000438943; ENSG00000102048 [Q96DX5-2]
GeneIDi140462
KEGGihsa:140462
UCSCiuc004cwk.4 human [Q96DX5-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
140462

GeneCards: human genes, protein and diseases

More...
GeneCardsi
ASB9
HGNCiHGNC:17184 ASB9
HPAiCAB004997
HPA003014
HPA003060
MIMi300890 gene
neXtProtiNX_Q96DX5
OpenTargetsiENSG00000102048
PharmGKBiPA25037

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG0504 Eukaryota
COG0666 LUCA
GeneTreeiENSGT00940000157160
HOGENOMiCLU_000134_4_0_1
InParanoidiQ96DX5
KOiK10331
OMAiHVTCVSL
OrthoDBi1546307at2759
PhylomeDBiQ96DX5
TreeFamiTF331945

Enzyme and pathway databases

UniPathwayiUPA00143
ReactomeiR-HSA-8951664 Neddylation
R-HSA-983168 Antigen processing: Ubiquitination & Proteasome degradation

Miscellaneous databases

EvolutionaryTraceiQ96DX5

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
140462
PharosiQ96DX5 Tbio

Protein Ontology

More...
PROi
PR:Q96DX5
RNActiQ96DX5 protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000102048 Expressed in right testis and 120 other tissues
ExpressionAtlasiQ96DX5 baseline and differential
GenevisibleiQ96DX5 HS

Family and domain databases

CDDicd03728 SOCS_ASB_9_11, 1 hit
Gene3Di1.25.40.20, 1 hit
InterProiView protein in InterPro
IPR002110 Ankyrin_rpt
IPR020683 Ankyrin_rpt-contain_dom
IPR036770 Ankyrin_rpt-contain_sf
IPR037333 ASB9/11_SOCS
IPR001496 SOCS_box
IPR036036 SOCS_box-like_dom_sf
PfamiView protein in Pfam
PF12796 Ank_2, 2 hits
PF07525 SOCS_box, 1 hit
SMARTiView protein in SMART
SM00248 ANK, 6 hits
SM00969 SOCS_box, 1 hit
SUPFAMiSSF158235 SSF158235, 1 hit
SSF48403 SSF48403, 1 hit
PROSITEiView protein in PROSITE
PS50297 ANK_REP_REGION, 1 hit
PS50088 ANK_REPEAT, 5 hits
PS50225 SOCS, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiASB9_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q96DX5
Secondary accession number(s): A8K8A5
, Q9BVF5, Q9NWS5, Q9Y4T3
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 28, 2003
Last sequence update: December 1, 2001
Last modified: February 26, 2020
This is version 164 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Reference proteome

Documents

  1. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  3. SIMILARITY comments
    Index of protein domains and families
  4. Human chromosome X
    Human chromosome X: entries, gene names and cross-references to MIM
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again