Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Ankyrin repeat and SOCS box protein 9

Gene

ASB9

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Substrate-recognition component of a SCF-like ECS (Elongin-Cullin-SOCS-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. Recognizes at least two forms of creatine kinase, CKB and CKMT1A.1 Publication

Pathwayi: protein ubiquitination

This protein is involved in the pathway protein ubiquitination, which is part of Protein modification.
View all proteins of this organism that are known to be involved in the pathway protein ubiquitination and in Protein modification.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sitei103Essential for binding to CKB1
Sitei107Essential for binding to CKB1

GO - Biological processi

Keywordsi

Biological processUbl conjugation pathway

Enzyme and pathway databases

ReactomeiR-HSA-8951664 Neddylation
R-HSA-983168 Antigen processing: Ubiquitination & Proteasome degradation
UniPathwayi
UPA00143

Names & Taxonomyi

Protein namesi
Recommended name:
Ankyrin repeat and SOCS box protein 9
Short name:
ASB-9
Gene namesi
Name:ASB9
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome X

Organism-specific databases

EuPathDBiHostDB:ENSG00000102048.15
HGNCiHGNC:17184 ASB9
MIMi300890 gene
neXtProtiNX_Q96DX5

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Mitochondrion

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000102048
PharmGKBiPA25037

Polymorphism and mutation databases

BioMutaiASB9
DMDMi29839756

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000669401 – 294Ankyrin repeat and SOCS box protein 9Add BLAST294

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei1N-acetylmethionineCombined sources1
Modified residuei51PhosphoserineCombined sources1

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

EPDiQ96DX5
MaxQBiQ96DX5
PaxDbiQ96DX5
PeptideAtlasiQ96DX5
PRIDEiQ96DX5
ProteomicsDBi76334
76335 [Q96DX5-2]
76336 [Q96DX5-3]

2D gel databases

REPRODUCTION-2DPAGEiIPI00179183

PTM databases

iPTMnetiQ96DX5
PhosphoSitePlusiQ96DX5

Expressioni

Tissue specificityi

Predominantly expressed in testis, kidney, and liver.1 Publication

Gene expression databases

BgeeiENSG00000102048 Expressed in 121 organ(s), highest expression level in right testis
CleanExiHS_ASB9
ExpressionAtlasiQ96DX5 baseline and differential
GenevisibleiQ96DX5 HS

Organism-specific databases

HPAiCAB004997
HPA003014
HPA003060

Interactioni

Binary interactionsi

Protein-protein interaction databases

BioGridi126615, 36 interactors
CORUMiQ96DX5
DIPiDIP-52905N
IntActiQ96DX5, 12 interactors
MINTiQ96DX5
STRINGi9606.ENSP00000369855

Structurei

Secondary structure

1294
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

ProteinModelPortaliQ96DX5
SMRiQ96DX5
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ96DX5

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Repeati35 – 64ANK 1Add BLAST30
Repeati68 – 97ANK 2Add BLAST30
Repeati101 – 130ANK 3Add BLAST30
Repeati133 – 162ANK 4Add BLAST30
Repeati166 – 195ANK 5Add BLAST30
Repeati198 – 227ANK 6Add BLAST30
Domaini240 – 294SOCS boxPROSITE-ProRule annotationAdd BLAST55

Domaini

The SOCS box domain mediates the interaction with the Elongin BC complex, an adapter module in different E3 ubiquitin-protein ligase complexes.By similarity

Sequence similaritiesi

Belongs to the ankyrin SOCS box (ASB) family.Curated

Keywords - Domaini

ANK repeat, Repeat

Phylogenomic databases

eggNOGiKOG0504 Eukaryota
COG0666 LUCA
GeneTreeiENSGT00930000150865
HOGENOMiHOG000231513
HOVERGENiHBG001376
InParanoidiQ96DX5
KOiK10331
OMAiRKCFGIQ
OrthoDBiEOG091G0DYR
PhylomeDBiQ96DX5
TreeFamiTF331945

Family and domain databases

CDDicd00204 ANK, 1 hit
cd03728 SOCS_ASB_9_11, 1 hit
Gene3Di1.25.40.20, 1 hit
InterProiView protein in InterPro
IPR002110 Ankyrin_rpt
IPR020683 Ankyrin_rpt-contain_dom
IPR036770 Ankyrin_rpt-contain_sf
IPR037333 ASB9/11_SOCS
IPR001496 SOCS_box
IPR036036 SOCS_box-like_dom_sf
PfamiView protein in Pfam
PF12796 Ank_2, 2 hits
PF07525 SOCS_box, 1 hit
SMARTiView protein in SMART
SM00248 ANK, 6 hits
SM00969 SOCS_box, 1 hit
SUPFAMiSSF158235 SSF158235, 1 hit
SSF48403 SSF48403, 1 hit
PROSITEiView protein in PROSITE
PS50297 ANK_REP_REGION, 1 hit
PS50088 ANK_REPEAT, 5 hits
PS50225 SOCS, 1 hit

Sequences (3+)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q96DX5-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MDGKQGGMDG SKPAGPRDFP GIRLLSNPLM GDAVSDWSPM HEAAIHGHQL
60 70 80 90 100
SLRNLISQGW AVNIITADHV SPLHEACLGG HLSCVKILLK HGAQVNGVTA
110 120 130 140 150
DWHTPLFNAC VSGSWDCVNL LLQHGASVQP ESDLASPIHE AARRGHVECV
160 170 180 190 200
NSLIAYGGNI DHKISHLGTP LYLACENQQR ACVKKLLESG ADVNQGKGQD
210 220 230 240 250
SPLHAVARTA SEELACLLMD FGADTQAKNA EGKRPVELVP PESPLAQLFL
260 270 280 290
EREGPPSLMQ LCRLRIRKCF GIQQHHKITK LVLPEDLKQF LLHL
Length:294
Mass (Da):31,858
Last modified:December 1, 2001 - v1
Checksum:iA1784DCFC294D85A
GO
Isoform 2 (identifier: Q96DX5-2) [UniParc]FASTAAdd to basket
Also known as: ASB9deltaSOCS

The sequence of this isoform differs from the canonical sequence as follows:
     255-294: PPSLMQLCRLRIRKCFGIQQHHKITKLVLPEDLKQFLLHL → ASLPKPKP

Note: Does not interact with the Elongin BC complex, likely to be a negative regulator of isoform 1.
Show »
Length:262
Mass (Da):27,902
Checksum:i9354CAD758EC399F
GO
Isoform 3 (identifier: Q96DX5-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     145-154: Missing.
     255-294: PPSLMQLCRLRIRKCFGIQQHHKITKLVLPEDLKQFLLHL → ASLPKPKP

Note: No experimental confirmation available.
Show »
Length:252
Mass (Da):26,849
Checksum:i6FEE897C6B1FF98C
GO

Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
R4GN94R4GN94_HUMAN
Ankyrin repeat and SOCS box protein...
ASB9
211Annotation score:

Sequence cautioni

The sequence CAB45706 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti192D → V in CAB45706 (PubMed:17974005).Curated1
Sequence conflicti237E → G in CAB45706 (PubMed:17974005).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_043158145 – 154Missing in isoform 3. 1 Publication10
Alternative sequenceiVSP_000271255 – 294PPSLM…FLLHL → ASLPKPKP in isoform 2 and isoform 3. 3 PublicationsAdd BLAST40

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK000643 mRNA Translation: BAA91302.1
AK292270 mRNA Translation: BAF84959.1
AL080091 mRNA Translation: CAB45706.2 Different initiation.
CH471074 Genomic DNA Translation: EAW98871.1
CH471074 Genomic DNA Translation: EAW98874.1
BC001244 mRNA Translation: AAH01244.1
BC013172 mRNA Translation: AAH13172.1
CCDSiCCDS14163.1 [Q96DX5-2]
CCDS35208.1 [Q96DX5-1]
CCDS55372.1 [Q96DX5-3]
RefSeqiNP_001026909.1, NM_001031739.2 [Q96DX5-1]
NP_001162002.1, NM_001168530.1 [Q96DX5-3]
NP_001162003.1, NM_001168531.1 [Q96DX5-2]
NP_076992.1, NM_024087.2 [Q96DX5-2]
XP_005274503.1, XM_005274446.1 [Q96DX5-1]
UniGeneiHs.19404

Genome annotation databases

EnsembliENST00000380483; ENSP00000369850; ENSG00000102048 [Q96DX5-3]
ENST00000380485; ENSP00000369852; ENSG00000102048 [Q96DX5-2]
ENST00000380488; ENSP00000369855; ENSG00000102048 [Q96DX5-1]
ENST00000546332; ENSP00000438943; ENSG00000102048 [Q96DX5-2]
GeneIDi140462
KEGGihsa:140462
UCSCiuc004cwk.4 human [Q96DX5-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK000643 mRNA Translation: BAA91302.1
AK292270 mRNA Translation: BAF84959.1
AL080091 mRNA Translation: CAB45706.2 Different initiation.
CH471074 Genomic DNA Translation: EAW98871.1
CH471074 Genomic DNA Translation: EAW98874.1
BC001244 mRNA Translation: AAH01244.1
BC013172 mRNA Translation: AAH13172.1
CCDSiCCDS14163.1 [Q96DX5-2]
CCDS35208.1 [Q96DX5-1]
CCDS55372.1 [Q96DX5-3]
RefSeqiNP_001026909.1, NM_001031739.2 [Q96DX5-1]
NP_001162002.1, NM_001168530.1 [Q96DX5-3]
NP_001162003.1, NM_001168531.1 [Q96DX5-2]
NP_076992.1, NM_024087.2 [Q96DX5-2]
XP_005274503.1, XM_005274446.1 [Q96DX5-1]
UniGeneiHs.19404

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
3D9HX-ray2.20A1-258[»]
3ZKJX-ray2.58A/D35-294[»]
3ZNGX-ray2.85A/D35-294[»]
ProteinModelPortaliQ96DX5
SMRiQ96DX5
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi126615, 36 interactors
CORUMiQ96DX5
DIPiDIP-52905N
IntActiQ96DX5, 12 interactors
MINTiQ96DX5
STRINGi9606.ENSP00000369855

PTM databases

iPTMnetiQ96DX5
PhosphoSitePlusiQ96DX5

Polymorphism and mutation databases

BioMutaiASB9
DMDMi29839756

2D gel databases

REPRODUCTION-2DPAGEiIPI00179183

Proteomic databases

EPDiQ96DX5
MaxQBiQ96DX5
PaxDbiQ96DX5
PeptideAtlasiQ96DX5
PRIDEiQ96DX5
ProteomicsDBi76334
76335 [Q96DX5-2]
76336 [Q96DX5-3]

Protocols and materials databases

DNASUi140462
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000380483; ENSP00000369850; ENSG00000102048 [Q96DX5-3]
ENST00000380485; ENSP00000369852; ENSG00000102048 [Q96DX5-2]
ENST00000380488; ENSP00000369855; ENSG00000102048 [Q96DX5-1]
ENST00000546332; ENSP00000438943; ENSG00000102048 [Q96DX5-2]
GeneIDi140462
KEGGihsa:140462
UCSCiuc004cwk.4 human [Q96DX5-1]

Organism-specific databases

CTDi140462
EuPathDBiHostDB:ENSG00000102048.15
GeneCardsiASB9
HGNCiHGNC:17184 ASB9
HPAiCAB004997
HPA003014
HPA003060
MIMi300890 gene
neXtProtiNX_Q96DX5
OpenTargetsiENSG00000102048
PharmGKBiPA25037
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG0504 Eukaryota
COG0666 LUCA
GeneTreeiENSGT00930000150865
HOGENOMiHOG000231513
HOVERGENiHBG001376
InParanoidiQ96DX5
KOiK10331
OMAiRKCFGIQ
OrthoDBiEOG091G0DYR
PhylomeDBiQ96DX5
TreeFamiTF331945

Enzyme and pathway databases

UniPathwayi
UPA00143

ReactomeiR-HSA-8951664 Neddylation
R-HSA-983168 Antigen processing: Ubiquitination & Proteasome degradation

Miscellaneous databases

EvolutionaryTraceiQ96DX5
GenomeRNAii140462
PROiPR:Q96DX5
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000102048 Expressed in 121 organ(s), highest expression level in right testis
CleanExiHS_ASB9
ExpressionAtlasiQ96DX5 baseline and differential
GenevisibleiQ96DX5 HS

Family and domain databases

CDDicd00204 ANK, 1 hit
cd03728 SOCS_ASB_9_11, 1 hit
Gene3Di1.25.40.20, 1 hit
InterProiView protein in InterPro
IPR002110 Ankyrin_rpt
IPR020683 Ankyrin_rpt-contain_dom
IPR036770 Ankyrin_rpt-contain_sf
IPR037333 ASB9/11_SOCS
IPR001496 SOCS_box
IPR036036 SOCS_box-like_dom_sf
PfamiView protein in Pfam
PF12796 Ank_2, 2 hits
PF07525 SOCS_box, 1 hit
SMARTiView protein in SMART
SM00248 ANK, 6 hits
SM00969 SOCS_box, 1 hit
SUPFAMiSSF158235 SSF158235, 1 hit
SSF48403 SSF48403, 1 hit
PROSITEiView protein in PROSITE
PS50297 ANK_REP_REGION, 1 hit
PS50088 ANK_REPEAT, 5 hits
PS50225 SOCS, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiASB9_HUMAN
AccessioniPrimary (citable) accession number: Q96DX5
Secondary accession number(s): A8K8A5
, Q9BVF5, Q9NWS5, Q9Y4T3
Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 28, 2003
Last sequence update: December 1, 2001
Last modified: November 7, 2018
This is version 155 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  4. Human chromosome X
    Human chromosome X: entries, gene names and cross-references to MIM
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again