UniProtKB - Q96D42 (HAVR1_HUMAN)

BLAST

>sp|Q96D42|HAVR1_HUMAN Hepatitis A virus cellular receptor 1 OS=Homo sapiens OX=9606 GN=HAVCR1 PE=1 SV=2
MHPQVVILSLILHLADSVAGSVKVGGEAGPSVTLPCHYSGAVTSMCWNRGSCSLFTCQNG
IVWTNGTHVTYRKDTRYKLLGDLSRRDVSLTIENTAVSDSGVYCCRVEHRGWFNDMKITV
SLEIVPPKVTTTPIVTTVPTVTTVRTSTTVPTTTTVPTTTVPTTMSIPTTTTVLTTMTVS
TTTSVPTTTSIPTTTSVPVTTTVSTFVPPMPLPRQNHEPVATSPSSPQPAETHPTTLQGA
IRREPTSSPLYSYTTDGNDTVTESSDGLWNNNQTQLFLEHSLLTANTTKGIYAGVCISVL
VLLALLGVIIAKKYFFKKEVQQLSVSFSSLQIKALQNAVEKEVQAEDNIYIENSLYATD

Align
Format
Add to basket Added to basket
History
Entry version 138 (10 Oct 2018)
Sequence version 2 (30 Aug 2005)
Previous versions | rss
Other tutorials and videos
Help video
Feedback

Protein

Hepatitis A virus cellular receptor 1

Gene

HAVCR1

Organism

Homo sapiens (Human)

Status

Reviewed-Annotation score: -Experimental evidence at protein levelⁱ

Functionⁱ

May play a role in T-helper cell development and the regulation of asthma and allergic diseases. Receptor for TIMD4 (By similarity). May play a role in kidney injury and repair.By similarity1 Publication

(Microbial infection) Acts as a receptor for Hepatitis A virus.2 Publications

(Microbial infection) Acts as a receptor for Dengue virus by binding exposed phosphatidyl-serine at the surface of virion membrane.1 Publication

Miscellaneous

The extracellular part of the protein can be cleaved and detected in urine and is in correlation with the expression in the kidney.

GO - Molecular functionⁱ

virus receptor activity
Source: CACAO
Inferred from direct assayⁱ
- 21536871

View the complete GO annotation on QuickGO ...

Keywordsⁱ

Molecular function	Host cell receptor for virus entry, Receptor
Biological process	Host-virus interaction

Names & Taxonomyⁱ

Protein namesⁱ	Recommended name: Hepatitis A virus cellular receptor 1 Short name: HAVcr-1 Alternative name(s): Kidney injury molecule 1 Short name: KIM-1 T-cell immunoglobulin and mucin domain-containing protein 1 Short name: TIMD-1 T-cell immunoglobulin mucin receptor 1 Short name: TIM Short name: TIM-1 T-cell membrane protein 1 CD_antigen: CD365
Gene namesⁱ	Name:HAVCR1 Synonyms:KIM1, TIM1, TIMD1
Organismⁱ	Homo sapiens (Human)
Taxonomic identifierⁱ	9606 [NCBI]
Taxonomic lineageⁱ	cellular organisms › Eukaryota › Opisthokonta › Metazoa › Eumetazoa › Bilateria › Deuterostomia › Chordata › Craniata › Vertebrata › Gnathostomata › Teleostomi › Euteleostomi › Sarcopterygii › Dipnotetrapodomorpha › Tetrapoda › Amniota › Mammalia › Theria › Eutheria › Boreoeutheria › Euarchontoglires › Primates › Haplorrhini › Simiiformes › Catarrhini › Hominoidea › Hominidae › Homininae › Homo
Proteomesⁱ	UP000005640 Componentⁱ: Chromosome 5

Organism-specific databases

EuPathDBⁱ	HostDB:ENSG00000113249.12
Human Gene Nomenclature Database More...HGNCⁱ	HGNC:17866 HAVCR1
MIMⁱ	606518 gene
neXtProtⁱ	NX_Q96D42

Topology

Feature key	Position(s)	DescriptionActions	Length
Topological domainⁱ	21 – 290	ExtracellularSequence analysisAdd BLAST	270
Transmembraneⁱ	291 – 311	HelicalSequence analysisAdd BLAST	21
Topological domainⁱ	312 – 359	CytoplasmicSequence analysisAdd BLAST	48

Keywords - Cellular componentⁱ

Membrane

Pathology & Biotechⁱ

Organism-specific databases

DisGeNET More...DisGeNETⁱ	26762
MalaCards human disease database More...MalaCardsⁱ	HAVCR1
PharmGKBⁱ	PA134924567

Polymorphism and mutation databases

BioMutaⁱ	HAVCR1
DMDMⁱ	73919877

PTM / Processingⁱ

Molecule processing

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Signal peptideⁱ	1 – 20	Sequence analysisAdd BLAST		20
ChainⁱPRO_0000014981	21 – 359	Hepatitis A virus cellular receptor 1Add BLAST		339

Amino acid modifications

Feature key	Position(s)	DescriptionActions	Length
Disulfide bondⁱ	36 ↔ 105	PROSITE-ProRule annotation
Disulfide bondⁱ	46 ↔ 57	PROSITE-ProRule annotation
Disulfide bondⁱ	52 ↔ 104	PROSITE-ProRule annotation
Glycosylationⁱ	65	N-linked (GlcNAc...) asparagineSequence analysis	1
Glycosylationⁱ	258	N-linked (GlcNAc...) asparagineSequence analysis	1
Glycosylationⁱ	272	N-linked (GlcNAc...) asparagineSequence analysis	1
Glycosylationⁱ	286	N-linked (GlcNAc...) asparagineSequence analysis	1

Keywords - PTMⁱ

Disulfide bond, Glycoprotein

Proteomic databases

MaxQB - The MaxQuant DataBase More...MaxQBⁱ	Q96D42
PaxDbⁱ	Q96D42
PeptideAtlas More...PeptideAtlasⁱ	Q96D42
PRIDEⁱ	Q96D42
ProteomicsDBⁱ	76250

PTM databases

iPTMnetⁱ	Q96D42
PhosphoSitePlusⁱ	Q96D42

Expressionⁱ

Tissue specificityⁱ

Widely expressed, with highest levels in kidney and testis. Expressed by activated CD4+ T-cells during the development of helper T-cells responses.1 Publication

Inductionⁱ

Up-regulated in the kidney in renal diseases (at protein level).1 Publication

Gene expression databases

Bgeeⁱ	ENSG00000113249 Expressed in 77 organ(s), highest expression level in adult mammalian kidney
CleanExⁱ	HS_HAVCR1
ExpressionAtlasⁱ	Q96D42 baseline and differential
Genevisibleⁱ	Q96D42 HS

Organism-specific databases

Human Protein Atlas More...HPAⁱ	CAB075697 HPA007173

HPAⁱ

CAB075697
HPA007173

Interactionⁱ

Subunit structureⁱ

(Microbial infection) Interacts with hepatitis A virus capsid proteins.2 Publications

Protein-protein interaction databases

BioGridⁱ	117812, 1 interactor
IntActⁱ	Q96D42, 3 interactors
STRINGⁱ	9606.ENSP00000344844

Structureⁱ

Secondary structure

Legend: HelixTurnBeta strandPDB Structure known for this area

Feature key	Position(s)	DescriptionActions	Length
Beta strandⁱ	22 – 30	Combined sources	9
Beta strandⁱ	32 – 34	Combined sources	3
Beta strandⁱ	45 – 50	Combined sources	6
Turnⁱ	56 – 59	Combined sources	4
Beta strandⁱ	60 – 64	Combined sources	5
Beta strandⁱ	66 – 74	Combined sources	9
Helixⁱ	83 – 85	Combined sources	3
Beta strandⁱ	90 – 94	Combined sources	5
Helixⁱ	97 – 99	Combined sources	3
Beta strandⁱ	101 – 107	Combined sources	7
Beta strandⁱ	110 – 113	Combined sources	4
Beta strandⁱ	116 – 125	Combined sources	10

Show more details

3D structure databases

ProteinModelPortalⁱ	Q96D42
SMRⁱ	Q96D42
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Family & Domainsⁱ

Domains and Repeats

Feature key	Position(s)	DescriptionActions	Length
Domainⁱ	21 – 121	Ig-like V-typeAdd BLAST	101
Repeatⁱ	138 – 143	1	6
Repeatⁱ	144 – 149	2	6
Repeatⁱ	150 – 155	3	6
Repeatⁱ	156 – 160	4	5
Repeatⁱ	161 – 166	5	6
Repeatⁱ	167 – 172	6	6
Repeatⁱ	173 – 178	7	6
Repeatⁱ	179 – 184	8	6
Repeatⁱ	185 – 190	9	6
Repeatⁱ	191 – 196	10	6
Repeatⁱ	197 – 202	11	6

Region

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Regionⁱ	138 – 202	11 X 6 AA approximate tandem repeats of V-P-T-T-T-T]Add BLAST		65

Compositional bias

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Compositional biasⁱ	130 – 205	Thr-richAdd BLAST		76

Sequence similaritiesⁱ

Belongs to the immunoglobulin superfamily. TIM family.Curated

Keywords - Domainⁱ

Immunoglobulin domain, Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGⁱ	ENOG410IZDR Eukaryota ENOG410YSF7 LUCA
InParanoidⁱ	Q96D42
KEGG Orthology (KO) More...KOⁱ	K20413
PhylomeDBⁱ	Q96D42
TreeFamⁱ	TF336163

Family and domain databases

Gene3Dⁱ	2.60.40.10, 1 hit
InterProⁱ	View protein in InterPro IPR007110 Ig-like_dom IPR036179 Ig-like_dom_sf IPR013783 Ig-like_fold IPR003006 Ig/MHC_CS IPR003599 Ig_sub IPR013106 Ig_V-set
Pfam protein domain database More...Pfamⁱ	View protein in Pfam PF07686 V-set, 1 hit
SMARTⁱ	View protein in SMART SM00409 IG, 1 hit
SUPFAMⁱ	SSF48726 SSF48726, 1 hit
PROSITEⁱ	View protein in PROSITE PS50835 IG_LIKE, 1 hit PS00290 IG_MHC, 1 hit

Sequence (1+)ⁱ

Sequence statusⁱ: Complete.

Sequence processingⁱ: The displayed sequence is further processed into a mature form.

This entry has 1 described isoform and 2 potential isoforms that are computationally mapped.Show all Align All

Q96D42-1 [UniParc]FASTA Add to basket

« Hide

        10         20         30         40         50
MHPQVVILSL ILHLADSVAG SVKVGGEAGP SVTLPCHYSG AVTSMCWNRG 
        60         70         80         90        100
SCSLFTCQNG IVWTNGTHVT YRKDTRYKLL GDLSRRDVSL TIENTAVSDS 
       110        120        130        140        150
GVYCCRVEHR GWFNDMKITV SLEIVPPKVT TTPIVTTVPT VTTVRTSTTV 
       160        170        180        190        200
PTTTTVPTTT VPTTMSIPTT TTVLTTMTVS TTTSVPTTTS IPTTTSVPVT 
       210        220        230        240        250
TTVSTFVPPM PLPRQNHEPV ATSPSSPQPA ETHPTTLQGA IRREPTSSPL 
       260        270        280        290        300
YSYTTDGNDT VTESSDGLWN NNQTQLFLEH SLLTANTTKG IYAGVCISVL 
       310        320        330        340        350
VLLALLGVII AKKYFFKKEV QQLSVSFSSL QIKALQNAVE KEVQAEDNIY 

IENSLYATD

Length:359

Mass (Da):38,720

Last modified:August 30, 2005 - v2

Checksum:ⁱD24BA2C932903ECA

Computationally mapped potential isoform sequencesⁱ

There are 2 potential isoforms mapped to this entry.BLAST Align Show all Add to basket

Entry	Entry name	Protein names	Gene names	Length	Annotation

E9PFX0	E9PFX0_HUMAN	Hepatitis A virus cellular receptor... Hepatitis A virus cellular receptor 1	HAVCR1	401	Annotation score:
E5RIF6	E5RIF6_HUMAN	Hepatitis A virus cellular receptor... Hepatitis A virus cellular receptor 1	HAVCR1	223	Annotation score:

Experimental Info

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Sequence conflictⁱ	174	L → P in AAC39862 (PubMed:9658108).Curated		1

Polymorphismⁱ

Infection by hepatitis A virus (HAV) protects individuals from atopy if they carry insertion of the variants Met-Thr-Thr-Val-Pro-157 and Met-Thr-Thr-Thr-Val-Pro-157. Modernisation has led to a reduction in HAV seroprevalence and thus, may be, to an increase of expression of atopy, such as asthma, allergic rhinitis and atopic dermatitis. Allelic variation does not affect HAV-infection rates in Caucasians, Asians and African Americans.1 Publication

Natural variant

Feature key	Position(s)	DescriptionActions	Length
Natural variantⁱVAR_056080	51	S → L. Corresponds to variant dbSNP:rs2270922Ensembl.	1
Natural variantⁱVAR_023321	157	P → PMTTTVP.	1
Natural variantⁱVAR_023322	157	P → PMTTVP3 Publications	1
Natural variantⁱVAR_023323	195	Missing 1 Publication	1

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	AF043724 mRNA Translation: AAC39862.1 CR457114 mRNA Translation: CAG33395.1 AC026777 Genomic DNA No translation available. BC013325 mRNA Translation: AAH13325.1
NCBI Reference Sequences More...RefSeqⁱ	NP_001166864.1, NM_001173393.2 NP_001295085.1, NM_001308156.1 NP_036338.2, NM_012206.3
UniGeneⁱ	Hs.129711

Genome annotation databases

Ensemblⁱ	ENST00000339252; ENSP00000344844; ENSG00000113249 ENST00000523175; ENSP00000427898; ENSG00000113249
GeneIDⁱ	26762
KEGGⁱ	hsa:26762
UCSC genome browser More...UCSCⁱ	uc003lwi.3 human

Keywords - Coding sequence diversityⁱ

Polymorphism

Similar proteinsⁱ

90% Identity
50% Identity

Protein	Similar proteins		Species	Score	Length	Source
Q96D42	HAVCR1 isoform 2		PONAB		376	UniRef90_Q96D42
HAVCR1 isoform 2		PANTR		365
Hepatitis A virus cellular receptor 1b		HUMAN		359
Hepatitis A virus cellular receptor 1		GORGO		359
HAVCR1 isoform 6 (Fragment)		PANTR		329
+5

Protein	Similar proteins		Species	Score	Length	Source
Q96D42	HAVCR1 isoform 2		PONAB		376	UniRef50_Q96D42
HAVCR1 isoform 2		PANTR		365
Hepatitis A virus cellular receptor 1a		HUMAN		359
Hepatitis A virus cellular receptor 1		GORGO		359
Uncharacterized protein		RHIRO		336
+28

Cross-referencesⁱ

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	AF043724 mRNA Translation: AAC39862.1 CR457114 mRNA Translation: CAG33395.1 AC026777 Genomic DNA No translation available. BC013325 mRNA Translation: AAH13325.1
RefSeqⁱ	NP_001166864.1, NM_001173393.2 NP_001295085.1, NM_001308156.1 NP_036338.2, NM_012206.3
UniGeneⁱ	Hs.129711

3D structure databases

Select the link destinations: Protein Data Bank Europe More...PDBeⁱ Protein Data Bank RCSB More...RCSB PDBⁱ Protein Data Bank Japan More...PDBjⁱ Links Updated	PDB entry	Method	Resolution (Å)	Chain	Positions	PDBsum
	5DZO	X-ray	1.30	A	22-127	[»]
	5F70	X-ray	1.80	A	21-123	[»]
ProteinModelPortalⁱ	Q96D42
SMRⁱ	Q96D42
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Protein-protein interaction databases

BioGridⁱ	117812, 1 interactor
IntActⁱ	Q96D42, 3 interactors
STRINGⁱ	9606.ENSP00000344844

PTM databases

iPTMnetⁱ	Q96D42
PhosphoSitePlusⁱ	Q96D42

Polymorphism and mutation databases

BioMutaⁱ	HAVCR1
DMDMⁱ	73919877

Proteomic databases

MaxQBⁱ	Q96D42
PaxDbⁱ	Q96D42
PeptideAtlasⁱ	Q96D42
PRIDEⁱ	Q96D42
ProteomicsDBⁱ	76250

Protocols and materials databases

The DNASU plasmid repository More...DNASUⁱ	26762
Structural Biology Knowledgebase	Search...

Genome annotation databases

Ensemblⁱ	ENST00000339252; ENSP00000344844; ENSG00000113249 ENST00000523175; ENSP00000427898; ENSG00000113249
GeneIDⁱ	26762
KEGGⁱ	hsa:26762
UCSCⁱ	uc003lwi.3 human

Organism-specific databases

CTDⁱ	26762
DisGeNETⁱ	26762
EuPathDBⁱ	HostDB:ENSG00000113249.12
GeneCardsⁱ	HAVCR1
HGNCⁱ	HGNC:17866 HAVCR1
HPAⁱ	CAB075697 HPA007173
MalaCardsⁱ	HAVCR1
MIMⁱ	606518 gene
neXtProtⁱ	NX_Q96D42
PharmGKBⁱ	PA134924567
GenAtlas: human gene database More...GenAtlasⁱ	Search...

Phylogenomic databases

eggNOGⁱ	ENOG410IZDR Eukaryota ENOG410YSF7 LUCA
InParanoidⁱ	Q96D42
KOⁱ	K20413
PhylomeDBⁱ	Q96D42
TreeFamⁱ	TF336163

Miscellaneous databases

ChiTaRSⁱ	HAVCR1 human
GeneWikiⁱ	HAVCR1
GenomeRNAiⁱ	26762
Protein Ontology More...PROⁱ	PR:Q96D42
SOURCEⁱ	Search...

Gene expression databases

Bgeeⁱ	ENSG00000113249 Expressed in 77 organ(s), highest expression level in adult mammalian kidney
CleanExⁱ	HS_HAVCR1
ExpressionAtlasⁱ	Q96D42 baseline and differential
Genevisibleⁱ	Q96D42 HS

Family and domain databases

Gene3Dⁱ	2.60.40.10, 1 hit
InterProⁱ	View protein in InterPro IPR007110 Ig-like_dom IPR036179 Ig-like_dom_sf IPR013783 Ig-like_fold IPR003006 Ig/MHC_CS IPR003599 Ig_sub IPR013106 Ig_V-set
Pfamⁱ	View protein in Pfam PF07686 V-set, 1 hit
SMARTⁱ	View protein in SMART SM00409 IG, 1 hit
SUPFAMⁱ	SSF48726 SSF48726, 1 hit
PROSITEⁱ	View protein in PROSITE PS50835 IG_LIKE, 1 hit PS00290 IG_MHC, 1 hit
ProtoNetⁱ	Search...

Entry informationⁱ

Entry nameⁱ	HAVR1_HUMAN
Accessionⁱ	Q96D42Primary (citable) accession number: Q96D42 Secondary accession number(s): O43656
Entry historyⁱ	Integrated into UniProtKB/Swiss-Prot:	August 30, 2005
	Last sequence update:	August 30, 2005
	Last modified:	October 10, 2018
	This is version 138 of the entry and version 2 of the sequence. See complete history.
Entry statusⁱ	Reviewed (UniProtKB/Swiss-Prot)
Annotation program	Chordata Protein Annotation Program
Disclaimer	Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousⁱ

Keywords - Technical termⁱ

3D-structure, Complete proteome, Reference proteome

Documents

Human chromosome 5
Human chromosome 5: entries, gene names and cross-references to MIM
Human entries with polymorphisms or disease mutations
List of human entries with polymorphisms or disease mutations
Human cell differentiation molecules
CD nomenclature of surface proteins of human leucocytes and list of entries
SIMILARITY comments
Index of protein domains and families
PDB cross-references
Index of Protein Data Bank (PDB) cross-references
Human polymorphisms and disease mutations
Index of human polymorphisms and disease mutations
MIM cross-references
Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

UniProtKB

UniParc

Help

UniRef

Proteomes

Annotation systems

Supporting data

UniProtKB - Q96D42 (HAVR1_HUMAN)

Your basket is currently empty. i <p>When browsing through different UniProt proteins, you can use the ‘basket’ to save them, so that you can back to find or analyse them later.<p><a href='/help/basket' target='_top'>More...</a></p>

Hepatitis A virus cellular receptor 1

HAVCR1

Select a section on the left to see content.

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Miscellaneous

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

Organism-specific databases

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Other locations

Other locations

Topology

Keywords - Cellular componenti

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

Polymorphism and mutation databases

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Amino acid modifications

Keywords - PTMi

Proteomic databases

PTM databases

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Organism-specific databases

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

3D structure databases

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Region

Compositional bias

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Keywords - Domaini

Phylogenomic databases

Family and domain databases

Experimental Info

Natural variant

Sequence databases

Genome annotation databases

Keywords - Coding sequence diversityi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

3D structure databases

Protein-protein interaction databases

PTM databases

Polymorphism and mutation databases

Proteomic databases

Protocols and materials databases

Genome annotation databases

Organism-specific databases

Phylogenomic databases

Miscellaneous databases

Gene expression databases

Family and domain databases

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Documents

UniProt is an ELIXIR core data resource

Your basket is currently empty. ⁱ

Functionⁱ

GO - Molecular functionⁱ

Names & Taxonomyⁱ

Subcellular locationⁱ

Keywords - Cellular componentⁱ

Pathology & Biotechⁱ

PTM / Processingⁱ

Keywords - PTMⁱ

Expressionⁱ

Interactionⁱ

Structureⁱ

Family & Domainsⁱ

Sequence similaritiesⁱ

Keywords - Domainⁱ

Keywords - Coding sequence diversityⁱ

Cross-referencesⁱ

Entry informationⁱ

Miscellaneousⁱ

Keywords - Technical termⁱ