Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Uncharacterized protein FAM241B

Gene

FAM241B

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Names & Taxonomyi

Protein namesi
Recommended name:
Uncharacterized protein FAM241B
Gene namesi
Name:FAM241BImported
Synonyms:C10orf35
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 10

Organism-specific databases

EuPathDBiHostDB:ENSG00000171224.8
HGNCiHGNC:23519 FAM241B
neXtProtiNX_Q96D05

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Transmembranei92 – 112HelicalSequence analysisAdd BLAST21

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Organism-specific databases

DisGeNETi219738
OpenTargetsiENSG00000171224
PharmGKBiPA134863788

Polymorphism and mutation databases

BioMutaiC10orf35
DMDMi68565253

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000897901 – 121Uncharacterized protein FAM241BAdd BLAST121

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei33PhosphoserineCombined sources1
Modified residuei62PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ96D05
MaxQBiQ96D05
PaxDbiQ96D05
PeptideAtlasiQ96D05
PRIDEiQ96D05
ProteomicsDBi76242
76243 [Q96D05-2]
TopDownProteomicsiQ96D05-1 [Q96D05-1]
Q96D05-2 [Q96D05-2]

PTM databases

iPTMnetiQ96D05
PhosphoSitePlusiQ96D05

Expressioni

Gene expression databases

BgeeiENSG00000171224 Expressed in 144 organ(s), highest expression level in cerebellum
CleanExiHS_C10orf35
ExpressionAtlasiQ96D05 baseline and differential
GenevisibleiQ96D05 HS

Organism-specific databases

HPAiHPA034591

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
SYNE4Q8N2053EBI-2548784,EBI-7131783

Protein-protein interaction databases

BioGridi128570, 24 interactors
IntActiQ96D05, 18 interactors
STRINGi9606.ENSP00000362376

Structurei

3D structure databases

ProteinModelPortaliQ96D05
SMRiQ96D05
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the FAM241 family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiENOG410J073 Eukaryota
ENOG410XYRT LUCA
GeneTreeiENSGT00390000009341
HOGENOMiHOG000007946
HOVERGENiHBG056578
InParanoidiQ96D05
OMAiRQGFLNR
OrthoDBiEOG091G12QE
PhylomeDBiQ96D05
TreeFamiTF335755

Family and domain databases

InterProiView protein in InterPro
IPR027953 DUF4605
PfamiView protein in Pfam
PF15378 DUF4605, 1 hit

Sequences (2+)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q96D05-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MVRILANGEI VQDDDPRVRT TTQPPRGSIP RQSFFNRGHG APPGGPGPRQ
60 70 80 90 100
QQAGARLGAA QSPFNDLNRQ LVNMGFPQWH LGNHAVEPVT SILLLFLLMM
110 120
LGVRGLLLVG LVYLVSHLSQ R
Length:121
Mass (Da):13,238
Last modified:December 1, 2001 - v1
Checksum:i6326728CAB5375C4
GO
Isoform 2 (identifier: Q96D05-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MSPVLSGIHSIYSAWVTSVNITDCKPPSISGAAHQGPTAPGRM

Show »
Length:163
Mass (Da):17,512
Checksum:iDB1F7BEA8307C5DE
GO

Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
Q5VVH9Q5VVH9_HUMAN
Uncharacterized protein FAM241B
FAM241B
103Annotation score:

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0421531M → MSPVLSGIHSIYSAWVTSVN ITDCKPPSISGAAHQGPTAP GRM in isoform 2. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AL450311 Genomic DNA No translation available.
BC013587 mRNA Translation: AAH13587.1
DB456046 mRNA No translation available.
CCDSiCCDS7295.1 [Q96D05-1]
RefSeqiNP_660349.1, NM_145306.2 [Q96D05-1]
XP_005269663.1, XM_005269606.1 [Q96D05-2]
XP_005269665.1, XM_005269608.3 [Q96D05-1]
XP_011537757.1, XM_011539455.2 [Q96D05-1]
XP_016871325.1, XM_017015836.1 [Q96D05-1]
UniGeneiHs.522992

Genome annotation databases

EnsembliENST00000373279; ENSP00000362376; ENSG00000171224 [Q96D05-1]
GeneIDi219738
KEGGihsa:219738
UCSCiuc001jpq.5 human [Q96D05-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AL450311 Genomic DNA No translation available.
BC013587 mRNA Translation: AAH13587.1
DB456046 mRNA No translation available.
CCDSiCCDS7295.1 [Q96D05-1]
RefSeqiNP_660349.1, NM_145306.2 [Q96D05-1]
XP_005269663.1, XM_005269606.1 [Q96D05-2]
XP_005269665.1, XM_005269608.3 [Q96D05-1]
XP_011537757.1, XM_011539455.2 [Q96D05-1]
XP_016871325.1, XM_017015836.1 [Q96D05-1]
UniGeneiHs.522992

3D structure databases

ProteinModelPortaliQ96D05
SMRiQ96D05
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi128570, 24 interactors
IntActiQ96D05, 18 interactors
STRINGi9606.ENSP00000362376

PTM databases

iPTMnetiQ96D05
PhosphoSitePlusiQ96D05

Polymorphism and mutation databases

BioMutaiC10orf35
DMDMi68565253

Proteomic databases

EPDiQ96D05
MaxQBiQ96D05
PaxDbiQ96D05
PeptideAtlasiQ96D05
PRIDEiQ96D05
ProteomicsDBi76242
76243 [Q96D05-2]
TopDownProteomicsiQ96D05-1 [Q96D05-1]
Q96D05-2 [Q96D05-2]

Protocols and materials databases

DNASUi219738
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000373279; ENSP00000362376; ENSG00000171224 [Q96D05-1]
GeneIDi219738
KEGGihsa:219738
UCSCiuc001jpq.5 human [Q96D05-1]

Organism-specific databases

CTDi219738
DisGeNETi219738
EuPathDBiHostDB:ENSG00000171224.8
GeneCardsiFAM241B
H-InvDBiHIX0008889
HGNCiHGNC:23519 FAM241B
HPAiHPA034591
neXtProtiNX_Q96D05
OpenTargetsiENSG00000171224
PharmGKBiPA134863788
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410J073 Eukaryota
ENOG410XYRT LUCA
GeneTreeiENSGT00390000009341
HOGENOMiHOG000007946
HOVERGENiHBG056578
InParanoidiQ96D05
OMAiRQGFLNR
OrthoDBiEOG091G12QE
PhylomeDBiQ96D05
TreeFamiTF335755

Miscellaneous databases

ChiTaRSiC10orf35 human
GenomeRNAii219738
PROiPR:Q96D05

Gene expression databases

BgeeiENSG00000171224 Expressed in 144 organ(s), highest expression level in cerebellum
CleanExiHS_C10orf35
ExpressionAtlasiQ96D05 baseline and differential
GenevisibleiQ96D05 HS

Family and domain databases

InterProiView protein in InterPro
IPR027953 DUF4605
PfamiView protein in Pfam
PF15378 DUF4605, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiF241B_HUMAN
AccessioniPrimary (citable) accession number: Q96D05
Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 5, 2005
Last sequence update: December 1, 2001
Last modified: November 7, 2018
This is version 117 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 10
    Human chromosome 10: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again