UniProtKB - Q96C28 (ZN707_HUMAN)

BLAST

>sp|Q96C28|ZN707_HUMAN Zinc finger protein 707 OS=Homo sapiens OX=9606 GN=ZNF707 PE=1 SV=2
MDMAQEPVTFRDVAIYFSREEWACLEPSQRALYRDVMLDNFSSVAALGFCSPRPDLVSRL
EQWEEPWVEDRERPEFQAVQRGPRPGARKSADPKRPCDHPAWAHKKTHVRRERAREGSSF
RKGFRLDTDDGQLPRAAPERTDAKPTAFPCQVLTQRCGRRPGRRERRKQRAVELSFICGT
CGKALSCHSRLLAHQTVHTGTKAFECPECGQTFRWASNLQRHQKNHTREKPFCCEACGQA
FSLKDRLAQHRKVHTEHRPYSCGDCGKAFKQKSNLLRHQLVHTGERPFYCADCGKAFRTK
ENLSHHQRVHSGEKPYTCAECGKSFRWPKGFSIHRRLHLTKRFYECGHCGKGFRHLGFFT
RHQRTHRHGEV

Align
Format
Add to basket Added to basket
History
Entry version 141 (07 Nov 2018)
Sequence version 2 (18 May 2010)
Previous versions | rss
Other tutorials and videos
Help video
Feedback

Protein

Zinc finger protein 707

Gene

ZNF707

Organism

Homo sapiens (Human)

Status

Reviewed-Annotation score: -Experimental evidence at protein levelⁱ

Functionⁱ

May be involved in transcriptional regulation.

Regions

Feature key	Position(s)	DescriptionActions	Length
Zinc fingerⁱ	176 – 198	C2H2-type 1PROSITE-ProRule annotationAdd BLAST	23
Zinc fingerⁱ	204 – 226	C2H2-type 2PROSITE-ProRule annotationAdd BLAST	23
Zinc fingerⁱ	232 – 254	C2H2-type 3PROSITE-ProRule annotationAdd BLAST	23
Zinc fingerⁱ	260 – 282	C2H2-type 4PROSITE-ProRule annotationAdd BLAST	23
Zinc fingerⁱ	288 – 310	C2H2-type 5PROSITE-ProRule annotationAdd BLAST	23
Zinc fingerⁱ	316 – 338	C2H2-type 6PROSITE-ProRule annotationAdd BLAST	23
Zinc fingerⁱ	344 – 366	C2H2-type 7PROSITE-ProRule annotationAdd BLAST	23

GO - Molecular functionⁱ

DNA binding Source: UniProtKB-KW
DNA-binding transcription factor activity, RNA polymerase II-specific Source: NTNU_SB
metal ion binding Source: UniProtKB-KW

View the complete GO annotation on QuickGO ...

Keywordsⁱ

Molecular function	DNA-binding
Biological process	Transcription, Transcription regulation
Ligand	Metal-binding, Zinc

Enzyme and pathway databases

Reactomeⁱ	R-HSA-212436 Generic Transcription Pathway

Reactomeⁱ

R-HSA-212436 Generic Transcription Pathway

Names & Taxonomyⁱ

Protein namesⁱ	Recommended name: Zinc finger protein 707
Gene namesⁱ	Name:ZNF707
Organismⁱ	Homo sapiens (Human)
Taxonomic identifierⁱ	9606 [NCBI]
Taxonomic lineageⁱ	cellular organisms › Eukaryota › Opisthokonta › Metazoa › Eumetazoa › Bilateria › Deuterostomia › Chordata › Craniata › Vertebrata › Gnathostomata › Teleostomi › Euteleostomi › Sarcopterygii › Dipnotetrapodomorpha › Tetrapoda › Amniota › Mammalia › Theria › Eutheria › Boreoeutheria › Euarchontoglires › Primates › Haplorrhini › Simiiformes › Catarrhini › Hominoidea › Hominidae › Homininae › Homo
Proteomesⁱ	UP000005640 Componentⁱ: Chromosome 8

Organism-specific databases

EuPathDBⁱ	HostDB:ENSG00000181135.15
Human Gene Nomenclature Database More...HGNCⁱ	HGNC:27815 ZNF707
neXtProtⁱ	NX_Q96C28

Keywords - Cellular componentⁱ

Nucleus

Pathology & Biotechⁱ

Organism-specific databases

Open Targets More...OpenTargetsⁱ	ENSG00000181135
PharmGKBⁱ	PA142670506

Polymorphism and mutation databases

BioMutaⁱ	ZNF707
DMDMⁱ	296453056

PTM / Processingⁱ

Molecule processing

Feature key	Position(s)	DescriptionActions	Graphical view	Length
ChainⁱPRO_0000233284	1 – 371	Zinc finger protein 707Add BLAST		371

Amino acid modifications

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Cross-linkⁱ	144	Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources

Keywords - PTMⁱ

Isopeptide bond, Ubl conjugation

Proteomic databases

EPDⁱ	Q96C28
PaxDbⁱ	Q96C28
PeptideAtlas More...PeptideAtlasⁱ	Q96C28
PRIDEⁱ	Q96C28
ProteomicsDBⁱ	76154

PTM databases

iPTMnetⁱ	Q96C28
PhosphoSitePlusⁱ	Q96C28

Expressionⁱ

Gene expression databases

Bgeeⁱ	ENSG00000181135 Expressed in 157 organ(s), highest expression level in right testis
CleanExⁱ	HS_ZNF707
ExpressionAtlasⁱ	Q96C28 baseline and differential
Genevisibleⁱ	Q96C28 HS

Organism-specific databases

Human Protein Atlas More...HPAⁱ	HPA044991

HPAⁱ

HPA044991

Interactionⁱ

Binary interactionsⁱ

With	Entry	#Exp.	IntAct
CCNDBP1	O95273	5	EBI-748111,EBI-748961
KRTAP10-5	P60370	3	EBI-748111,EBI-10172150
KRTAP10-7	P60409	3	EBI-748111,EBI-10172290
MDFI	Q99750	4	EBI-748111,EBI-724076
RALBP1	Q15311	5	EBI-748111,EBI-749285

Protein-protein interaction databases

BioGridⁱ	130290, 59 interactors
IntActⁱ	Q96C28, 10 interactors
STRINGⁱ	9606.ENSP00000351482

Structureⁱ

3D structure databases

ProteinModelPortalⁱ	Q96C28
SMRⁱ	Q96C28
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Family & Domainsⁱ

Domains and Repeats

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Domainⁱ	8 – 79	KRABPROSITE-ProRule annotationAdd BLAST		72

Sequence similaritiesⁱ

Belongs to the krueppel C2H2-type zinc-finger protein family.Curated

Zinc finger

Feature key	Position(s)	DescriptionActions	Length
Zinc fingerⁱ	176 – 198	C2H2-type 1PROSITE-ProRule annotationAdd BLAST	23
Zinc fingerⁱ	204 – 226	C2H2-type 2PROSITE-ProRule annotationAdd BLAST	23
Zinc fingerⁱ	232 – 254	C2H2-type 3PROSITE-ProRule annotationAdd BLAST	23
Zinc fingerⁱ	260 – 282	C2H2-type 4PROSITE-ProRule annotationAdd BLAST	23
Zinc fingerⁱ	288 – 310	C2H2-type 5PROSITE-ProRule annotationAdd BLAST	23
Zinc fingerⁱ	316 – 338	C2H2-type 6PROSITE-ProRule annotationAdd BLAST	23
Zinc fingerⁱ	344 – 366	C2H2-type 7PROSITE-ProRule annotationAdd BLAST	23

Keywords - Domainⁱ

Repeat, Zinc-finger

Phylogenomic databases

eggNOGⁱ	KOG1721 Eukaryota COG5048 LUCA
Ensembl GeneTree More...GeneTreeⁱ	ENSGT00930000150903
HOGENOMⁱ	HOG000234617
HOVERGENⁱ	HBG018163
InParanoidⁱ	Q96C28
KEGG Orthology (KO) More...KOⁱ	K09228
OMAⁱ	WAHKKTH
Database of Orthologous Groups More...OrthoDBⁱ	EOG091G0P6J
PhylomeDBⁱ	Q96C28
TreeFamⁱ	TF337055

Family and domain databases

Conserved Domains Database More...CDDⁱ	cd07765 KRAB_A-box, 1 hit
InterProⁱ	View protein in InterPro IPR001909 KRAB IPR036051 KRAB_dom_sf IPR036236 Znf_C2H2_sf IPR013087 Znf_C2H2_type
Pfam protein domain database More...Pfamⁱ	View protein in Pfam PF01352 KRAB, 1 hit PF00096 zf-C2H2, 5 hits
SMARTⁱ	View protein in SMART SM00349 KRAB, 1 hit SM00355 ZnF_C2H2, 7 hits
SUPFAMⁱ	SSF109640 SSF109640, 1 hit SSF57667 SSF57667, 4 hits
PROSITEⁱ	View protein in PROSITE PS50805 KRAB, 1 hit PS00028 ZINC_FINGER_C2H2_1, 7 hits PS50157 ZINC_FINGER_C2H2_2, 7 hits

Sequence (1+)ⁱ

Sequence statusⁱ: Complete.

This entry has 1 described isoform and 9 potential isoforms that are computationally mapped.Show all Align All

Q96C28-1 [UniParc]FASTA Add to basket

« Hide

        10         20         30         40         50
MDMAQEPVTF RDVAIYFSRE EWACLEPSQR ALYRDVMLDN FSSVAALGFC 
        60         70         80         90        100
SPRPDLVSRL EQWEEPWVED RERPEFQAVQ RGPRPGARKS ADPKRPCDHP 
       110        120        130        140        150
AWAHKKTHVR RERAREGSSF RKGFRLDTDD GQLPRAAPER TDAKPTAFPC 
       160        170        180        190        200
QVLTQRCGRR PGRRERRKQR AVELSFICGT CGKALSCHSR LLAHQTVHTG 
       210        220        230        240        250
TKAFECPECG QTFRWASNLQ RHQKNHTREK PFCCEACGQA FSLKDRLAQH 
       260        270        280        290        300
RKVHTEHRPY SCGDCGKAFK QKSNLLRHQL VHTGERPFYC ADCGKAFRTK 
       310        320        330        340        350
ENLSHHQRVH SGEKPYTCAE CGKSFRWPKG FSIHRRLHLT KRFYECGHCG 
       360        370 
KGFRHLGFFT RHQRTHRHGE V

Length:371

Mass (Da):43,088

Last modified:May 18, 2010 - v2

Checksum:ⁱ113B680E5296FF3B

Computationally mapped potential isoform sequencesⁱ

There are 9 potential isoforms mapped to this entry.BLAST Align Show all Add to basket

Entry	Entry name	Protein names	Gene names	Length	Annotation

E9PJ46	E9PJ46_HUMAN	Zinc finger protein 707 Zinc finger protein 707	ZNF707	55	Annotation score:
E9PKX4	E9PKX4_HUMAN	Zinc finger protein 707 Zinc finger protein 707	ZNF707	92	Annotation score:
E9PNV7	E9PNV7_HUMAN	Zinc finger protein 707 Zinc finger protein 707	ZNF707	141	Annotation score:
E9PP66	E9PP66_HUMAN	Zinc finger protein 707 Zinc finger protein 707	ZNF707	103	Annotation score:
E9PQ20	E9PQ20_HUMAN	Zinc finger protein 707 Zinc finger protein 707	ZNF707	79	Annotation score:
E9PPS7	E9PPS7_HUMAN	Zinc finger protein 707 Zinc finger protein 707	ZNF707	134	Annotation score:
E9PHZ0	E9PHZ0_HUMAN	Zinc finger protein 707 Zinc finger protein 707	ZNF707	47	Annotation score:
E9PS67	E9PS67_HUMAN	Zinc finger protein 707 Zinc finger protein 707	ZNF707	145	Annotation score:
A0A2R8YE36	A0A2R8YE36_HUMAN	Zinc finger protein 707 Zinc finger protein 707	ZNF707	296	Annotation score:

Sequence cautionⁱ

The sequence AAH14894 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

The sequence BAF83121 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Experimental Info

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Sequence conflictⁱ	26	E → V in BAF83121 (PubMed:14702039).Curated		1
Sequence conflictⁱ	192	L → F in BAG51493 (PubMed:14702039).Curated		1

Natural variant

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Natural variantⁱVAR_033596	96	P → H2 PublicationsCorresponds to variant dbSNP:rs6987308Ensembl.		1

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	AK290432 mRNA Translation: BAF83121.1 Different initiation. AK055263 mRNA Translation: BAG51493.1 AC105219 Genomic DNA No translation available. CH471162 Genomic DNA Translation: EAW82210.1 CH471162 Genomic DNA Translation: EAW82211.1 CH471162 Genomic DNA Translation: EAW82214.1 BC014894 mRNA Translation: AAH14894.1 Different initiation.
The Consensus CDS (CCDS) project More...CCDSⁱ	CCDS47932.1
NCBI Reference Sequences More...RefSeqⁱ	NP_001094068.1, NM_001100598.1 NP_001094069.1, NM_001100599.1 NP_001275734.1, NM_001288805.1 NP_001275735.1, NM_001288806.1 NP_001275736.1, NM_001288807.1 NP_001275737.1, NM_001288808.1 NP_001275738.1, NM_001288809.1 NP_776192.2, NM_173831.3 XP_011515279.1, XM_011516977.2
UniGeneⁱ	Hs.521922

Genome annotation databases

Ensemblⁱ	ENST00000358656; ENSP00000351482; ENSG00000181135 ENST00000418203; ENSP00000413215; ENSG00000181135 ENST00000532158; ENSP00000436250; ENSG00000181135 ENST00000532205; ENSP00000436212; ENSG00000181135 ENST00000611146; ENSP00000484032; ENSG00000274352 ENST00000611844; ENSP00000481069; ENSG00000274352 ENST00000617261; ENSP00000484744; ENSG00000274352 ENST00000622212; ENSP00000481033; ENSG00000274352
GeneIDⁱ	286075
KEGGⁱ	hsa:286075
UCSC genome browser More...UCSCⁱ	uc003yze.5 human

Keywords - Coding sequence diversityⁱ

Polymorphism

Similar proteinsⁱ

100% Identity
90% Identity
50% Identity

Protein	Similar proteins		Species	Score	Length	Source
Q96C28	Zinc finger protein 707 (Fragment)		HUMAN		145	UniRef100_Q96C28
Zinc finger protein 707 (Fragment)		HUMAN		79
Zinc finger protein 707 (Fragment)		HUMAN		47
Zinc finger protein 707 (Fragment)		HUMAN		141
UPI000387B6C9		HUMAN		335

Protein	Similar proteins		Species	Score	Length	Source
Q96C28	Zinc finger protein 707 (Fragment)		HUMAN		145	UniRef90_Q96C28
Uncharacterized protein		PANPA		417
ZNF707 isoform 8 (Fragment)		PANTR		79
Uncharacterized protein		NOMLE		377
ZNF707 isoform 28		PONAB		372
+49

Protein	Similar proteins		Species	Score	Length	Source
Q96C28	Zinc finger protein 707 (Fragment)		HUMAN		145	UniRef50_Q96C28
Uncharacterized protein		PANPA		417
ZNF707 isoform 8 (Fragment)		PANTR		79
Uncharacterized protein		NOMLE		377
ZNF707 isoform 28		PONAB		372
+77

Cross-referencesⁱ

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	AK290432 mRNA Translation: BAF83121.1 Different initiation. AK055263 mRNA Translation: BAG51493.1 AC105219 Genomic DNA No translation available. CH471162 Genomic DNA Translation: EAW82210.1 CH471162 Genomic DNA Translation: EAW82211.1 CH471162 Genomic DNA Translation: EAW82214.1 BC014894 mRNA Translation: AAH14894.1 Different initiation.
CCDSⁱ	CCDS47932.1
RefSeqⁱ	NP_001094068.1, NM_001100598.1 NP_001094069.1, NM_001100599.1 NP_001275734.1, NM_001288805.1 NP_001275735.1, NM_001288806.1 NP_001275736.1, NM_001288807.1 NP_001275737.1, NM_001288808.1 NP_001275738.1, NM_001288809.1 NP_776192.2, NM_173831.3 XP_011515279.1, XM_011516977.2
UniGeneⁱ	Hs.521922

3D structure databases

ProteinModelPortalⁱ	Q96C28
SMRⁱ	Q96C28
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Protein-protein interaction databases

BioGridⁱ	130290, 59 interactors
IntActⁱ	Q96C28, 10 interactors
STRINGⁱ	9606.ENSP00000351482

PTM databases

iPTMnetⁱ	Q96C28
PhosphoSitePlusⁱ	Q96C28

Polymorphism and mutation databases

BioMutaⁱ	ZNF707
DMDMⁱ	296453056

Proteomic databases

EPDⁱ	Q96C28
PaxDbⁱ	Q96C28
PeptideAtlasⁱ	Q96C28
PRIDEⁱ	Q96C28
ProteomicsDBⁱ	76154

Protocols and materials databases

The DNASU plasmid repository More...DNASUⁱ	286075
Structural Biology Knowledgebase	Search...

Genome annotation databases

Ensemblⁱ	ENST00000358656; ENSP00000351482; ENSG00000181135 ENST00000418203; ENSP00000413215; ENSG00000181135 ENST00000532158; ENSP00000436250; ENSG00000181135 ENST00000532205; ENSP00000436212; ENSG00000181135 ENST00000611146; ENSP00000484032; ENSG00000274352 ENST00000611844; ENSP00000481069; ENSG00000274352 ENST00000617261; ENSP00000484744; ENSG00000274352 ENST00000622212; ENSP00000481033; ENSG00000274352
GeneIDⁱ	286075
KEGGⁱ	hsa:286075
UCSCⁱ	uc003yze.5 human

Organism-specific databases

CTDⁱ	286075
EuPathDBⁱ	HostDB:ENSG00000181135.15
GeneCardsⁱ	ZNF707
HGNCⁱ	HGNC:27815 ZNF707
HPAⁱ	HPA044991
neXtProtⁱ	NX_Q96C28
OpenTargetsⁱ	ENSG00000181135
PharmGKBⁱ	PA142670506
GenAtlas: human gene database More...GenAtlasⁱ	Search...

Phylogenomic databases

eggNOGⁱ	KOG1721 Eukaryota COG5048 LUCA
GeneTreeⁱ	ENSGT00930000150903
HOGENOMⁱ	HOG000234617
HOVERGENⁱ	HBG018163
InParanoidⁱ	Q96C28
KOⁱ	K09228
OMAⁱ	WAHKKTH
OrthoDBⁱ	EOG091G0P6J
PhylomeDBⁱ	Q96C28
TreeFamⁱ	TF337055

Enzyme and pathway databases

Reactomeⁱ	R-HSA-212436 Generic Transcription Pathway

Reactomeⁱ

R-HSA-212436 Generic Transcription Pathway

Miscellaneous databases

GenomeRNAiⁱ	286075
Protein Ontology More...PROⁱ	PR:Q96C28

Gene expression databases

Bgeeⁱ	ENSG00000181135 Expressed in 157 organ(s), highest expression level in right testis
CleanExⁱ	HS_ZNF707
ExpressionAtlasⁱ	Q96C28 baseline and differential
Genevisibleⁱ	Q96C28 HS

Family and domain databases

CDDⁱ	cd07765 KRAB_A-box, 1 hit
InterProⁱ	View protein in InterPro IPR001909 KRAB IPR036051 KRAB_dom_sf IPR036236 Znf_C2H2_sf IPR013087 Znf_C2H2_type
Pfamⁱ	View protein in Pfam PF01352 KRAB, 1 hit PF00096 zf-C2H2, 5 hits
SMARTⁱ	View protein in SMART SM00349 KRAB, 1 hit SM00355 ZnF_C2H2, 7 hits
SUPFAMⁱ	SSF109640 SSF109640, 1 hit SSF57667 SSF57667, 4 hits
PROSITEⁱ	View protein in PROSITE PS50805 KRAB, 1 hit PS00028 ZINC_FINGER_C2H2_1, 7 hits PS50157 ZINC_FINGER_C2H2_2, 7 hits
ProtoNetⁱ	Search...

Entry informationⁱ

Entry nameⁱ	ZN707_HUMAN
Accessionⁱ	Q96C28Primary (citable) accession number: Q96C28 Secondary accession number(s): A8K317, B3KNY1, D3DWK7
Entry historyⁱ	Integrated into UniProtKB/Swiss-Prot:	May 2, 2006
	Last sequence update:	May 18, 2010
	Last modified:	November 7, 2018
	This is version 141 of the entry and version 2 of the sequence. See complete history.
Entry statusⁱ	Reviewed (UniProtKB/Swiss-Prot)
Annotation program	Chordata Protein Annotation Program
Disclaimer	Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousⁱ

Keywords - Technical termⁱ

Complete proteome, Reference proteome

Documents

SIMILARITY comments
Index of protein domains and families
Human entries with polymorphisms or disease mutations
List of human entries with polymorphisms or disease mutations
Human polymorphisms and disease mutations
Index of human polymorphisms and disease mutations
Human chromosome 8
Human chromosome 8: entries, gene names and cross-references to MIM

UniProtKB

UniParc

Help

UniRef

Proteomes

Annotation systems

Supporting data

UniProtKB - Q96C28 (ZN707_HUMAN)

Your basket is currently empty. i <p>When browsing through different UniProt proteins, you can use the ‘basket’ to save them, so that you can back to find or analyse them later.<p><a href='/help/basket' target='_top'>More...</a></p>

Zinc finger protein 707

ZNF707

Select a section on the left to see content.

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Regions

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Enzyme and pathway databases

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

Organism-specific databases

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Nucleus

Nucleus

Keywords - Cellular componenti

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

Polymorphism and mutation databases

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Amino acid modifications

Keywords - PTMi

Proteomic databases

PTM databases

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Organism-specific databases

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Zinc finger

Keywords - Domaini

Phylogenomic databases

Family and domain databases

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

Experimental Info

Natural variant

Sequence databases

Genome annotation databases

Keywords - Coding sequence diversityi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

3D structure databases

Protein-protein interaction databases

PTM databases

Polymorphism and mutation databases

Proteomic databases

Protocols and materials databases

Genome annotation databases

Organism-specific databases

Phylogenomic databases

Enzyme and pathway databases

Miscellaneous databases

Gene expression databases

Family and domain databases

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Documents

UniProt is an ELIXIR core data resource

Your basket is currently empty. ⁱ

Functionⁱ

GO - Molecular functionⁱ

Names & Taxonomyⁱ

Subcellular locationⁱ

Keywords - Cellular componentⁱ

Pathology & Biotechⁱ

PTM / Processingⁱ

Keywords - PTMⁱ

Expressionⁱ

Interactionⁱ

Structureⁱ

Family & Domainsⁱ

Sequence similaritiesⁱ

Keywords - Domainⁱ

Sequence cautionⁱ

Keywords - Coding sequence diversityⁱ

Cross-referencesⁱ

Entry informationⁱ

Miscellaneousⁱ

Keywords - Technical termⁱ