UniProtKB - Q96C23 (GALM_HUMAN)

BLAST

>sp|Q96C23|GALM_HUMAN Aldose 1-epimerase OS=Homo sapiens OX=9606 GN=GALM PE=1 SV=1
MASVTRAVFGELPSGGGTVEKFQLQSDLLRVDIISWGCTITALEVKDRQGRASDVVLGFA
ELEGYLQKQPYFGAVIGRVANRIAKGTFKVDGKEYHLAINKEPNSLHGGVRGFDKVLWTP
RVLSNGVQFSRISPDGEEGYPGELKVWVTYTLDGGELIVNYRAQASQATPVNLTNHSYFN
LAGQASPNINDHEVTIEADTYLPVDETLIPTGEVAPVQGTAFDLRKPVELGKHLQDFHLN
GFDHNFCLKGSKEKHFCARVHHAASGRVLEVYTTQPGVQFYTGNFLDGTLKGKNGAVYPK
HSGFCLETQNWPDAVNQPRFPPVLLRPGEEYDHTTWFKFSVA

Align
Format
Add to basket Added to basket
History
Entry version 142 (12 Sep 2018)
Sequence version 1 (01 Dec 2001)
Previous versions | rss
Other tutorials and videos
Help video
Feedback

Protein

Aldose 1-epimerase

Gene

GALM

Organism

Homo sapiens (Human)

Status

Reviewed-Annotation score: -Experimental evidence at protein levelⁱ

Functionⁱ

Mutarotase converts alpha-aldose to the beta-anomer. It is active on D-glucose, L-arabinose, D-xylose, D-galactose, maltose and lactose (By similarity).By similarity2 Publications

Catalytic activityⁱ

Alpha-D-glucose = beta-D-glucose.PROSITE-ProRule annotation

Pathwayⁱ: hexose metabolism

This protein is involved in the pathway hexose metabolism, which is part of Carbohydrate metabolism.
View all proteins of this organism that are known to be involved in the pathway hexose metabolism and in Carbohydrate metabolism.

Sites

Feature key	Position(s)	DescriptionActions	Length
Active siteⁱ	176	Proton donor	1
Binding siteⁱ	243	Substrate1 Publication	1
Active siteⁱ	307	Proton acceptor	1

GO - Molecular functionⁱ

aldose 1-epimerase activity
Source: UniProtKB
Inferred from direct assayⁱ
- 12753898
carbohydrate binding Source: InterPro

View the complete GO annotation on QuickGO ...

GO - Biological processⁱ

galactose catabolic process via UDP-galactose Source: GO_Central
galactose metabolic process
Source: UniProtKB
Inferred from direct assayⁱ
- 12753898
glucose metabolic process
Source: UniProtKB
Inferred from direct assayⁱ
- 12753898

View the complete GO annotation on QuickGO ...

Keywordsⁱ

Molecular function	Isomerase
Biological process	Carbohydrate metabolism

Enzyme and pathway databases

BioCycⁱ	MetaCyc:HS07125-MONOMER
BRENDAⁱ	5.1.3.3 2681
SABIO-RKⁱ	Q96C23
SignaLinkⁱ	Q96C23
UniPathwayⁱ	UPA00242

Names & Taxonomyⁱ

Protein namesⁱ	Recommended name: Aldose 1-epimerase (EC:5.1.3.3) Alternative name(s): Galactose mutarotase
Gene namesⁱ	Name:GALM ORF Names:BLOCK25
Organismⁱ	Homo sapiens (Human)
Taxonomic identifierⁱ	9606 [NCBI]
Taxonomic lineageⁱ	cellular organisms › Eukaryota › Opisthokonta › Metazoa › Eumetazoa › Bilateria › Deuterostomia › Chordata › Craniata › Vertebrata › Gnathostomata › Teleostomi › Euteleostomi › Sarcopterygii › Dipnotetrapodomorpha › Tetrapoda › Amniota › Mammalia › Theria › Eutheria › Boreoeutheria › Euarchontoglires › Primates › Haplorrhini › Simiiformes › Catarrhini › Hominoidea › Hominidae › Homininae › Homo
Proteomesⁱ	UP000005640 Componentⁱ: Chromosome 2

Organism-specific databases

EuPathDBⁱ	HostDB:ENSG00000143891.16
Human Gene Nomenclature Database More...HGNCⁱ	HGNC:24063 GALM
MIMⁱ	137030 gene
neXtProtⁱ	NX_Q96C23

Keywords - Cellular componentⁱ

Cytoplasm

Pathology & Biotechⁱ

Mutagenesis

Feature key	Position(s)	DescriptionActions	Length
Mutagenesisⁱ	107	H → A: Reduces activity over 5-fold. 1 Publication	1
Mutagenesisⁱ	176	H → A: Loss of activity. 1 Publication	1
Mutagenesisⁱ	307	E → A: Loss of activity. 1 Publication	1

Organism-specific databases

DisGeNET More...DisGeNETⁱ	130589
Open Targets More...OpenTargetsⁱ	ENSG00000143891
PharmGKBⁱ	PA134980075

Polymorphism and mutation databases

BioMutaⁱ	GALM
DMDMⁱ	67463772

PTM / Processingⁱ

Molecule processing

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Initiator methionineⁱ		RemovedCombined sources
ChainⁱPRO_0000197433	2 – 342	Aldose 1-epimeraseAdd BLAST		341

Amino acid modifications

Feature key	Position(s)	DescriptionActions	Length
Modified residueⁱ	2	N-acetylalanineCombined sources	1
Modified residueⁱ	14	PhosphoserineCombined sources	1
Modified residueⁱ	124	PhosphoserineBy similarity	1

Keywords - PTMⁱ

Acetylation, Phosphoprotein

Proteomic databases

EPDⁱ	Q96C23
MaxQB - The MaxQuant DataBase More...MaxQBⁱ	Q96C23
PaxDbⁱ	Q96C23
PeptideAtlas More...PeptideAtlasⁱ	Q96C23
PRIDEⁱ	Q96C23
ProteomicsDBⁱ	76151

PTM databases

iPTMnetⁱ	Q96C23
PhosphoSitePlusⁱ	Q96C23

Expressionⁱ

Gene expression databases

Bgeeⁱ	ENSG00000143891 Expressed in 208 organ(s), highest expression level in kidney epithelium
CleanExⁱ	HS_GALM
ExpressionAtlasⁱ	Q96C23 baseline and differential
Genevisibleⁱ	Q96C23 HS

Organism-specific databases

Human Protein Atlas More...HPAⁱ	HPA035472 HPA035473 HPA064835

HPAⁱ

HPA035472
HPA035473
HPA064835

Interactionⁱ

Subunit structureⁱ

Monomer.1 Publication

Protein-protein interaction databases

BioGridⁱ	126244, 5 interactors
IntActⁱ	Q96C23, 1 interactor
STRINGⁱ	9606.ENSP00000272252

Structureⁱ

Secondary structure

Legend: HelixTurnBeta strandPDB Structure known for this area

Feature key	Position(s)	DescriptionActions	Length
Beta strandⁱ	3 – 12	Combined sources	10
Turnⁱ	13 – 16	Combined sources	4
Beta strandⁱ	17 – 25	Combined sources	9
Beta strandⁱ	30 – 34	Combined sources	5
Beta strandⁱ	39 – 46	Combined sources	8
Beta strandⁱ	52 – 54	Combined sources	3
Helixⁱ	62 – 66	Combined sources	5
Beta strandⁱ	81 – 83	Combined sources	3
Helixⁱ	84 – 86	Combined sources	3
Beta strandⁱ	87 – 90	Combined sources	4
Beta strandⁱ	93 – 96	Combined sources	4
Beta strandⁱ	104 – 106	Combined sources	3
Beta strandⁱ	109 – 111	Combined sources	3
Helixⁱ	113 – 115	Combined sources	3
Beta strandⁱ	119 – 123	Combined sources	5
Beta strandⁱ	126 – 133	Combined sources	8
Helixⁱ	137 – 139	Combined sources	3
Beta strandⁱ	144 – 153	Combined sources	10
Beta strandⁱ	156 – 167	Combined sources	12
Beta strandⁱ	193 – 196	Combined sources	4
Beta strandⁱ	198 – 201	Combined sources	4
Helixⁱ	230 – 236	Combined sources	7
Beta strandⁱ	243 – 248	Combined sources	6
Beta strandⁱ	251 – 253	Combined sources	3
Beta strandⁱ	255 – 261	Combined sources	7
Turnⁱ	263 – 265	Combined sources	3
Beta strandⁱ	267 – 281	Combined sources	15
Beta strandⁱ	287 – 291	Combined sources	5
Helixⁱ	293 – 295	Combined sources	3
Beta strandⁱ	297 – 299	Combined sources	3
Beta strandⁱ	304 – 310	Combined sources	7
Helixⁱ	314 – 316	Combined sources	3
Beta strandⁱ	331 – 341	Combined sources	11

Show more details

3D structure databases

ProteinModelPortalⁱ	Q96C23
SMRⁱ	Q96C23
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Miscellaneous databases

EvolutionaryTraceⁱ	Q96C23

EvolutionaryTraceⁱ

Q96C23

Family & Domainsⁱ

Region

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Regionⁱ	81 – 82	Substrate binding		2

Sequence similaritiesⁱ

Belongs to the aldose epimerase family.Curated

Phylogenomic databases

eggNOGⁱ	KOG1604 Eukaryota COG2017 LUCA
Ensembl GeneTree More...GeneTreeⁱ	ENSGT00510000047589
HOGENOMⁱ	HOG000072798
HOVERGENⁱ	HBG051697
InParanoidⁱ	Q96C23
KEGG Orthology (KO) More...KOⁱ	K01785
OMAⁱ	ATWLSCK
Database of Orthologous Groups More...OrthoDBⁱ	EOG091G0COE
PhylomeDBⁱ	Q96C23
TreeFamⁱ	TF324207

Family and domain databases

Gene3Dⁱ	2.70.98.10, 1 hit
InterProⁱ	View protein in InterPro IPR018052 Ald1_epimerase_CS IPR015443 Aldose_1-epimerase IPR008183 Aldose_1/G6P_1-epimerase IPR011013 Gal_mutarotase_sf_dom IPR014718 GH-type_carb-bd
Pfam protein domain database More...Pfamⁱ	View protein in Pfam PF01263 Aldose_epim, 1 hit
PIRSFⁱ	PIRSF005096 GALM, 1 hit
SUPFAMⁱ	SSF74650 SSF74650, 1 hit
PROSITEⁱ	View protein in PROSITE PS00545 ALDOSE_1_EPIMERASE, 1 hit

Sequence (1+)ⁱ

Sequence statusⁱ: Complete.

Sequence processingⁱ: The displayed sequence is further processed into a mature form.

This entry has 1 described isoform and 3 potential isoforms that are computationally mapped.Show all Align All

Q96C23-1 [UniParc]FASTA Add to basket

« Hide

        10         20         30         40         50
MASVTRAVFG ELPSGGGTVE KFQLQSDLLR VDIISWGCTI TALEVKDRQG 
        60         70         80         90        100
RASDVVLGFA ELEGYLQKQP YFGAVIGRVA NRIAKGTFKV DGKEYHLAIN 
       110        120        130        140        150
KEPNSLHGGV RGFDKVLWTP RVLSNGVQFS RISPDGEEGY PGELKVWVTY 
       160        170        180        190        200
TLDGGELIVN YRAQASQATP VNLTNHSYFN LAGQASPNIN DHEVTIEADT 
       210        220        230        240        250
YLPVDETLIP TGEVAPVQGT AFDLRKPVEL GKHLQDFHLN GFDHNFCLKG 
       260        270        280        290        300
SKEKHFCARV HHAASGRVLE VYTTQPGVQF YTGNFLDGTL KGKNGAVYPK 
       310        320        330        340 
HSGFCLETQN WPDAVNQPRF PPVLLRPGEE YDHTTWFKFS VA

Length:342

Mass (Da):37,766

Last modified:December 1, 2001 - v1

Checksum:ⁱ611A54AE7E85813E

Computationally mapped potential isoform sequencesⁱ

There are 3 potential isoforms mapped to this entry.BLAST Align Show all Add to basket

Entry	Entry name	Protein names	Gene names	Length	Annotation

H7C320	H7C320_HUMAN	Aldose 1-epimerase Aldose 1-epimerase	GALM	194	Annotation score:
H7C1B5	H7C1B5_HUMAN	Aldose 1-epimerase Aldose 1-epimerase	GALM	218	Annotation score:
B8ZZ75	B8ZZ75_HUMAN	Aldose 1-epimerase Aldose 1-epimerase	GALM	194	Annotation score:

Sequence cautionⁱ

The sequence AAL62475 differs from that shown. Reason: Erroneous gene model prediction.Curated

Natural variant

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Natural variantⁱVAR_024451	190	N → Y. Corresponds to variant dbSNP:rs6741892Ensembl.		1

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	AY064382 AY064378 Genomic DNA Translation: AAL62475.1 Sequence problems. AY064385 AY064383 Genomic DNA Translation: AAL62476.1 EU794611 mRNA Translation: ACJ13665.1 AK291489 mRNA Translation: BAF84178.1 AC074366 Genomic DNA Translation: AAX93101.1 CH471053 Genomic DNA Translation: EAX00367.1 BC014916 mRNA Translation: AAH14916.1 BC019263 mRNA Translation: AAH19263.1
The Consensus CDS (CCDS) project More...CCDSⁱ	CCDS1797.1
NCBI Reference Sequences More...RefSeqⁱ	NP_620156.1, NM_138801.2 XP_011530842.1, XM_011532540.1
UniGeneⁱ	Hs.435012

Genome annotation databases

Ensemblⁱ	ENST00000272252; ENSP00000272252; ENSG00000143891
GeneIDⁱ	130589
KEGGⁱ	hsa:130589
UCSC genome browser More...UCSCⁱ	uc002rqy.4 human

Keywords - Coding sequence diversityⁱ

Polymorphism

Similar proteinsⁱ

90% Identity
50% Identity

Protein	Similar proteins		Species	Score	Length	Source
Q96C23	Aldose 1-epimerase		PONAB		342	UniRef90_Q96C23
Aldose 1-epimerase		RHIBE		344
Aldose 1-epimerase		RHIRO		333
Uncharacterized protein		MACMU		214
UPI0000351588		HUMAN		344
+4

Protein	Similar proteins		Species	Score	Length	Source
Q96C23	Aldose 1-epimerase		PONAB		342	UniRef50_Q96C23
Aldose 1-epimerase		RAT		342
Aldose 1-epimerase		MOUSE		342
Aldose 1-epimerase		RHIBE		344
Aldose 1-epimerase		RHIRO		333
+156

Cross-referencesⁱ

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	AY064382 AY064378 Genomic DNA Translation: AAL62475.1 Sequence problems. AY064385 AY064383 Genomic DNA Translation: AAL62476.1 EU794611 mRNA Translation: ACJ13665.1 AK291489 mRNA Translation: BAF84178.1 AC074366 Genomic DNA Translation: AAX93101.1 CH471053 Genomic DNA Translation: EAX00367.1 BC014916 mRNA Translation: AAH14916.1 BC019263 mRNA Translation: AAH19263.1
CCDSⁱ	CCDS1797.1
RefSeqⁱ	NP_620156.1, NM_138801.2 XP_011530842.1, XM_011532540.1
UniGeneⁱ	Hs.435012

3D structure databases

Select the link destinations: Protein Data Bank Europe More...PDBeⁱ Protein Data Bank RCSB More...RCSB PDBⁱ Protein Data Bank Japan More...PDBjⁱ Links Updated	PDB entry	Method	Resolution (Å)	Chain	Positions	PDBsum
	1SNZ	X-ray	2.20	A/B	1-342	[»]
	1SO0	X-ray	2.30	A/B/C/D	1-342	[»]
ProteinModelPortalⁱ	Q96C23
SMRⁱ	Q96C23
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Protein-protein interaction databases

BioGridⁱ	126244, 5 interactors
IntActⁱ	Q96C23, 1 interactor
STRINGⁱ	9606.ENSP00000272252

PTM databases

iPTMnetⁱ	Q96C23
PhosphoSitePlusⁱ	Q96C23

Polymorphism and mutation databases

BioMutaⁱ	GALM
DMDMⁱ	67463772

Proteomic databases

EPDⁱ	Q96C23
MaxQBⁱ	Q96C23
PaxDbⁱ	Q96C23
PeptideAtlasⁱ	Q96C23
PRIDEⁱ	Q96C23
ProteomicsDBⁱ	76151

Protocols and materials databases

Structural Biology Knowledgebase	Search...

Structural Biology Knowledgebase

Search...

Genome annotation databases

Ensemblⁱ	ENST00000272252; ENSP00000272252; ENSG00000143891
GeneIDⁱ	130589
KEGGⁱ	hsa:130589
UCSCⁱ	uc002rqy.4 human

Organism-specific databases

CTDⁱ	130589
DisGeNETⁱ	130589
EuPathDBⁱ	HostDB:ENSG00000143891.16
GeneCardsⁱ	GALM
HGNCⁱ	HGNC:24063 GALM
HPAⁱ	HPA035472 HPA035473 HPA064835
MIMⁱ	137030 gene
neXtProtⁱ	NX_Q96C23
OpenTargetsⁱ	ENSG00000143891
PharmGKBⁱ	PA134980075
GenAtlas: human gene database More...GenAtlasⁱ	Search...

Phylogenomic databases

eggNOGⁱ	KOG1604 Eukaryota COG2017 LUCA
GeneTreeⁱ	ENSGT00510000047589
HOGENOMⁱ	HOG000072798
HOVERGENⁱ	HBG051697
InParanoidⁱ	Q96C23
KOⁱ	K01785
OMAⁱ	ATWLSCK
OrthoDBⁱ	EOG091G0COE
PhylomeDBⁱ	Q96C23
TreeFamⁱ	TF324207

Enzyme and pathway databases

UniPathwayⁱ	UPA00242
BioCycⁱ	MetaCyc:HS07125-MONOMER
BRENDAⁱ	5.1.3.3 2681
SABIO-RKⁱ	Q96C23
SignaLinkⁱ	Q96C23

Miscellaneous databases

ChiTaRSⁱ	GALM human
EvolutionaryTraceⁱ	Q96C23
GeneWikiⁱ	Galactose_mutarotase
GenomeRNAiⁱ	130589
Protein Ontology More...PROⁱ	PR:Q96C23
SOURCEⁱ	Search...

Gene expression databases

Bgeeⁱ	ENSG00000143891 Expressed in 208 organ(s), highest expression level in kidney epithelium
CleanExⁱ	HS_GALM
ExpressionAtlasⁱ	Q96C23 baseline and differential
Genevisibleⁱ	Q96C23 HS

Family and domain databases

Gene3Dⁱ	2.70.98.10, 1 hit
InterProⁱ	View protein in InterPro IPR018052 Ald1_epimerase_CS IPR015443 Aldose_1-epimerase IPR008183 Aldose_1/G6P_1-epimerase IPR011013 Gal_mutarotase_sf_dom IPR014718 GH-type_carb-bd
Pfamⁱ	View protein in Pfam PF01263 Aldose_epim, 1 hit
PIRSFⁱ	PIRSF005096 GALM, 1 hit
SUPFAMⁱ	SSF74650 SSF74650, 1 hit
PROSITEⁱ	View protein in PROSITE PS00545 ALDOSE_1_EPIMERASE, 1 hit
ProtoNetⁱ	Search...

Entry informationⁱ

Entry nameⁱ	GALM_HUMAN
Accessionⁱ	Q96C23Primary (citable) accession number: Q96C23 Secondary accession number(s): Q53RY1, Q8NIA2, V9HWA8
Entry historyⁱ	Integrated into UniProtKB/Swiss-Prot:	May 10, 2005
	Last sequence update:	December 1, 2001
	Last modified:	September 12, 2018
	This is version 142 of the entry and version 1 of the sequence. See complete history.
Entry statusⁱ	Reviewed (UniProtKB/Swiss-Prot)
Annotation program	Chordata Protein Annotation Program
Disclaimer	Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousⁱ

Keywords - Technical termⁱ

3D-structure, Complete proteome, Reference proteome

Documents

Human chromosome 2
Human chromosome 2: entries, gene names and cross-references to MIM
Human entries with polymorphisms or disease mutations
List of human entries with polymorphisms or disease mutations
SIMILARITY comments
Index of protein domains and families
PATHWAY comments
Index of metabolic and biosynthesis pathways
PDB cross-references
Index of Protein Data Bank (PDB) cross-references
Human polymorphisms and disease mutations
Index of human polymorphisms and disease mutations
MIM cross-references
Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

UniProtKB

UniParc

Help

UniRef

Proteomes

Annotation systems

Supporting data

UniProtKB - Q96C23 (GALM_HUMAN)

Your basket is currently empty. i <p>When browsing through different UniProt proteins, you can use the ‘basket’ to save them, so that you can back to find or analyse them later.<p><a href='/help/basket' target='_top'>More...</a></p>

Aldose 1-epimerase

GALM

Select a section on the left to see content.

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section describes the metabolic pathway(s) associated with a protein.<p><a href='/help/pathway' target='_top'>More...</a></p>Pathwayi: hexose metabolism

Sites

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

Enzyme and pathway databases

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

Organism-specific databases

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Other locations

Extracellular region or secreted

Other locations

Keywords - Cellular componenti

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Organism-specific databases

Polymorphism and mutation databases

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Amino acid modifications

Keywords - PTMi

Proteomic databases

PTM databases

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Organism-specific databases

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

3D structure databases

Miscellaneous databases

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Phylogenomic databases

Family and domain databases

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

Natural variant

Sequence databases

Genome annotation databases

Keywords - Coding sequence diversityi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

3D structure databases

Protein-protein interaction databases

PTM databases

Polymorphism and mutation databases

Proteomic databases

Protocols and materials databases

Genome annotation databases

Organism-specific databases

Phylogenomic databases

Enzyme and pathway databases

Miscellaneous databases

Gene expression databases

Family and domain databases

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Documents

UniProt is an ELIXIR core data resource

Your basket is currently empty. ⁱ

Functionⁱ

Pathwayⁱ: hexose metabolism

GO - Molecular functionⁱ

GO - Biological processⁱ

Names & Taxonomyⁱ

Subcellular locationⁱ

Keywords - Cellular componentⁱ

Pathology & Biotechⁱ

PTM / Processingⁱ

Keywords - PTMⁱ

Expressionⁱ

Interactionⁱ

Structureⁱ

Family & Domainsⁱ

Sequence similaritiesⁱ

Sequence cautionⁱ

Keywords - Coding sequence diversityⁱ

Cross-referencesⁱ

Entry informationⁱ

Miscellaneousⁱ

Keywords - Technical termⁱ