Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Dedicator of cytokinesis protein 10

Gene

DOCK10

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Guanine nucleotide-exchange factor (GEF) that activates CDC42 and RAC1 by exchanging bound GDP for free GTP. Essential for dendritic spine morphogenesis in Purkinje cells and in hippocampal neurons, via a CDC42-mediated pathway. Sustains B-cell lymphopoiesis in secondary lymphoid tissues and regulates FCER2/CD23 expression.By similarity

Miscellaneous

'Zizim' means 'spike' in Hebrew.Curated

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionGuanine-nucleotide releasing factor

Enzyme and pathway databases

ReactomeiR-HSA-983231 Factors involved in megakaryocyte development and platelet production

Names & Taxonomyi

Protein namesi
Recommended name:
Dedicator of cytokinesis protein 10Curated
Alternative name(s):
Zizimin-3
Gene namesi
Name:DOCK10Imported
Synonyms:KIAA0694, ZIZ3
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 2

Organism-specific databases

EuPathDBiHostDB:ENSG00000135905.18
HGNCiHGNC:23479 DOCK10
MIMi611518 gene
neXtProtiNX_Q96BY6

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell projection, Cytoplasm, Nucleus

Pathology & Biotechi

Organism-specific databases

DisGeNETi55619
OpenTargetsiENSG00000135905
PharmGKBiPA134983197

Polymorphism and mutation databases

BioMutaiDOCK10
DMDMi332278210

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001900021 – 2186Dedicator of cytokinesis protein 10Add BLAST2186

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei196PhosphothreonineBy similarity1
Modified residuei302PhosphoserineBy similarity1
Modified residuei368PhosphothreonineBy similarity1
Modified residuei834N6-acetyllysineCombined sources1
Modified residuei877PhosphoserineBy similarity1
Modified residuei1232PhosphoserineCombined sources1
Modified residuei1257PhosphoserineBy similarity1
Modified residuei1292PhosphoserineCombined sources1
Modified residuei1295PhosphoserineCombined sources1
Modified residuei1318PhosphoserineCombined sources1
Modified residuei1406PhosphothreonineBy similarity1
Modified residuei1440PhosphothreonineCombined sources1

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

EPDiQ96BY6
MaxQBiQ96BY6
PaxDbiQ96BY6
PeptideAtlasiQ96BY6
PRIDEiQ96BY6
ProteomicsDBi76127
76128 [Q96BY6-2]

PTM databases

iPTMnetiQ96BY6
PhosphoSitePlusiQ96BY6

Expressioni

Tissue specificityi

Expressed at low level in brain and lung. Isoform 1 is enriched in normal T-cells, isoform 3 is enriched in normal B-cells and chronic lymphocytic leukemia (CLL) B-cells.3 Publications

Inductioni

Isoforms 1 and 2 are up-regulated in response to IL4 in B-cells but not T-cells.2 Publications

Gene expression databases

BgeeiENSG00000135905 Expressed in 192 organ(s), highest expression level in corpus callosum
CleanExiHS_DOCK10
ExpressionAtlasiQ96BY6 baseline and differential
GenevisibleiQ96BY6 HS

Organism-specific databases

HPAiHPA058106

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
MAGEA11P43364-23EBI-10282566,EBI-10178634

GO - Molecular functioni

Protein-protein interaction databases

BioGridi120758, 6 interactors
IntActiQ96BY6, 2 interactors
STRINGi9606.ENSP00000258390

Structurei

3D structure databases

ProteinModelPortaliQ96BY6
SMRiQ96BY6
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini181 – 290PHPROSITE-ProRule annotationAdd BLAST110
Domaini672 – 850DHR-1PROSITE-ProRule annotationAdd BLAST179
Domaini1690 – 2150DHR-2PROSITE-ProRule annotationAdd BLAST461

Domaini

The DHR-2 domain may mediate some GEF activity.By similarity

Sequence similaritiesi

Belongs to the DOCK family.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiKOG1997 Eukaryota
ENOG410XNVY LUCA
GeneTreeiENSGT00760000119234
HOGENOMiHOG000231373
HOVERGENiHBG107819
InParanoidiQ96BY6
KOiK21853
OMAiNSMMKRV
OrthoDBiEOG091G03FS
PhylomeDBiQ96BY6
TreeFamiTF313629

Family and domain databases

CDDicd08697 C2_Dock-D, 1 hit
Gene3Di2.30.29.30, 1 hit
2.60.40.150, 1 hit
InterProiView protein in InterPro
IPR037809 C2_Dock-D
IPR035892 C2_domain_sf
IPR027007 DHR-1_domain
IPR027357 DHR-2
IPR026791 DOCK
IPR010703 DOCK_C
IPR021816 DOCK_C/D_N
IPR011993 PH-like_dom_sf
IPR001849 PH_domain
PANTHERiPTHR23317 PTHR23317, 1 hit
PfamiView protein in Pfam
PF06920 DHR-2, 1 hit
PF14429 DOCK-C2, 1 hit
PF11878 DUF3398, 1 hit
PF00169 PH, 1 hit
SMARTiView protein in SMART
SM00233 PH, 1 hit
PROSITEiView protein in PROSITE
PS51650 DHR_1, 1 hit
PS51651 DHR_2, 1 hit
PS50003 PH_DOMAIN, 1 hit

Sequences (3+)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 6 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q96BY6-1) [UniParc]FASTAAdd to basket
Also known as: DOCK10.1

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAGERTRRFT RSLLRPGQAA ELRHSAASAA AVAVSSRQQQ RQEKPRLLEP
60 70 80 90 100
LDYETVIEEL EKTYRNDPLQ DLLFFPSDDF SAATVSWDIR TLYSTVPEDA
110 120 130 140 150
EHKAENLLVK EACKFYSSQW HVVNYKYEQY SGDIRQLPRA EYKPEKLPSH
160 170 180 190 200
SFEIDHEDAD KDEDTTSHSS SKGGGGAGGT GVFKSGWLYK GNFNSTVNNT
210 220 230 240 250
VTVRSFKKRY FQLTQLPDNS YIMNFYKDEK ISKEPKGCIF LDSCTGVVQN
260 270 280 290 300
NRLRKYAFEL KMNDLTYFVL AAETESDMDE WIHTLNRILQ ISPEGPLQGR
310 320 330 340 350
RSTELTDLGL DSLDNSVTCE CTPEETDSSE NNLHADFAKY LTETEDTVKT
360 370 380 390 400
TRNMERLNLF SLDPDIDTLK LQKKDLLEPE SVIKPFEEKA AKRIMIICKA
410 420 430 440 450
LNSNLQGCVT ENENDPITNI EPFFVSVALY DLRDSRKISA DFHVDLNHAA
460 470 480 490 500
VRQMLLGASV ALENGNIDTI TPRQSEEPHI KGLPEEWLKF PKQAVFSVSN
510 520 530 540 550
PHSEIVLVAK IEKVLMGNIA SGAEPYIKNP DSNKYAQKIL KSNRQFCSKL
560 570 580 590 600
GKYRMPFAWA VRSVFKDNQG NVDRDSRFSP LFRQESSKIS TEDLVKLVSD
610 620 630 640 650
YRRADRISKM QTIPGSLDIA VDNVPLEHPN CVTSSFIPVK PFNMMAQTEP
660 670 680 690 700
TVEVEEFVYD STKYCRPYRV YKNQIYIYPK HLKYDSQKCF NKARNITVCI
710 720 730 740 750
EFKNSDEESA KPLKCIYGKP GGPLFTSAAY TAVLHHSQNP DFSDEVKIEL
760 770 780 790 800
PTQLHEKHHI LFSFYHVTCD INAKANAKKK EALETSVGYA WLPLMKHDQI
810 820 830 840 850
ASQEYNIPIA TSLPPNYLSF QDSASGKHGG SDIKWVDGGK PLFKVSTFVV
860 870 880 890 900
STVNTQDPHV NAFFQECQKR EKDMSQSPTS NFIRSCKNLL NVEKIHAIMS
910 920 930 940 950
FLPIILNQLF KVLVQNEEDE ITTTVTRVLT DIVAKCHEEQ LDHSVQSYIK
960 970 980 990 1000
FVFKTRACKE RTVHEELAKN VTGLLKSNDS TTVKHVLKHS WFFFAIILKS
1010 1020 1030 1040 1050
MAQHLIDTNK IQLPRPQRFP ESYQNELDNL VMVLSDHVIW KYKDALEETR
1060 1070 1080 1090 1100
RANHSVARFL KRCFTFMDRG YVFKMVNNYI SMFSSGDLKT LCQYKFDFLQ
1110 1120 1130 1140 1150
EVCQHEHFIP LCLPIRSANI PDPLTPSEST QELHASDMPE YSVTNEFCRK
1160 1170 1180 1190 1200
HFLIGILLRE VGFALQEDQD VRHLALAVLK NLMAKHSFDD RYREPRKQAQ
1210 1220 1230 1240 1250
IASLYMPLYG MLLDNMPRIY LKDLYPFTVN TSNQGSRDDL STNGGFQSQT
1260 1270 1280 1290 1300
AIKHANSVDT SFSKDVLNSI AAFSSIAIST VNHADSRASL ASLDSNPSTN
1310 1320 1330 1340 1350
EKSSEKTDNC EKIPRPLSLI GSTLRFDKLD QAETRSLLMC FLHIMKTISY
1360 1370 1380 1390 1400
ETLIAYWQRA PSPEVSDFFS ILDVCLQNFR YLGKRNIIRK IAAAFKFVQS
1410 1420 1430 1440 1450
TQNNGTLKGS NPSCQTSGLL SQWMHSTSSH EGHKQHRSQT LPIIRGKNAL
1460 1470 1480 1490 1500
SNPKLLQMLD NTMTSNSNEI DIVHHVDTEA NIATEVCLTI LDLLSLFTQT
1510 1520 1530 1540 1550
HQRQLQQCDC QNSLMKRVFD TYMLFFQVNQ SATALKHVFA SLRLFVCKFP
1560 1570 1580 1590 1600
SAFFQGPADL CGSFCYEVLK CCNHRSRSTQ TEASALLYFF MRKNFEFNKQ
1610 1620 1630 1640 1650
KSIVRSHLQL IKAVSQLIAD AGIGGSRFQH SLAITNNFAN GDKQMKNSNF
1660 1670 1680 1690 1700
PAEVKDLTKR IRTVLMATAQ MKEHEKDPEM LVDLQYSLAN SYASTPELRR
1710 1720 1730 1740 1750
TWLESMAKIH ARNGDLSEAA MCYIHIAALI AEYLKRKGYW KVEKICTASL
1760 1770 1780 1790 1800
LSEDTHPCDS NSLLTTPSGG SMFSMGWPAF LSITPNIKEE GAMKEDSGMQ
1810 1820 1830 1840 1850
DTPYNENILV EQLYMCVEFL WKSERYELIA DVNKPIIAVF EKQRDFKKLS
1860 1870 1880 1890 1900
DLYYDIHRSY LKVAEVVNSE KRLFGRYYRV AFYGQGFFEE EEGKEYIYKE
1910 1920 1930 1940 1950
PKLTGLSEIS QRLLKLYADK FGADNVKIIQ DSNKVNPKDL DPKYAYIQVT
1960 1970 1980 1990 2000
YVTPFFEEKE IEDRKTDFEM HHNINRFVFE TPFTLSGKKH GGVAEQCKRR
2010 2020 2030 2040 2050
TILTTSHLFP YVKKRIQVIS QSSTELNPIE VAIDEMSKKV SELNQLCTME
2060 2070 2080 2090 2100
EVDMIRLQLK LQGSVSVKVN AGPMAYARAF LEETNAKKYP DNQVKLLKEI
2110 2120 2130 2140 2150
FRQFADACGQ ALDVNERLIK EDQLEYQEEL RSHYKDMLSE LSTVMNEQIT
2160 2170 2180
GRDDLSKRGV DQTCTRVISK ATPALPTVSI SSSAEV
Note: No experimental confirmation available.
Length:2,186
Mass (Da):249,531
Last modified:May 3, 2011 - v3
Checksum:i955ABC03DE2270AF
GO
Isoform 2 (identifier: Q96BY6-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     565-593: FKDNQGNVDRDSRFSPLFRQESSKISTED → DSCSQQTRNTFNGGIGSFSFERFCVAYYF
     594-2186: Missing.

Note: No experimental confirmation available.
Show »
Length:593
Mass (Da):67,378
Checksum:i4C41C48C2162ADB0
GO
Isoform 3 (identifier: Q96BY6-3) [UniParc]FASTAAdd to basket
Also known as: DOCK10.2

The sequence of this isoform differs from the canonical sequence as follows:
     1-41: MAGERTRRFT...VAVSSRQQQR → MSFRGKVFKREPSEFWKKRRTVRRVNQEEIHRFSS

Show »
Length:2,180
Mass (Da):249,491
Checksum:iE4A9EA93C9537982
GO

Computationally mapped potential isoform sequencesi

There are 6 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H0YFC5H0YFC5_HUMAN
Dedicator of cytokinesis protein 10
DOCK10
190Annotation score:
A0A2R8YD85A0A2R8YD85_HUMAN
Dedicator of cytokinesis protein 10
DOCK10
2,199Annotation score:
F8WE73F8WE73_HUMAN
Dedicator of cytokinesis protein 10
DOCK10
142Annotation score:
H7C0I3H7C0I3_HUMAN
Dedicator of cytokinesis protein 10
DOCK10
380Annotation score:
A0A2R8Y5U0A0A2R8Y5U0_HUMAN
Dedicator of cytokinesis protein 10
DOCK10
163Annotation score:
F8WB48F8WB48_HUMAN
Dedicator of cytokinesis protein 10
DOCK10
42Annotation score:

Sequence cautioni

The sequence AAH15018 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence BAA31669 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated
The sequence BAA91022 differs from that shown. Reason: Frameshift at position 2133.Curated
The sequence BAA91583 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence CAH18316 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti563S → Y in BAA31669 (PubMed:9734811).Curated1
Sequence conflicti1833N → D in BAA91583 (PubMed:14702039).Curated1
Sequence conflicti1966T → S in BAA91022 (PubMed:14702039).Curated1
Sequence conflicti2062Q → R in CAH18316 (PubMed:11230166).Curated1
Sequence conflicti2093Q → R in CAH18316 (PubMed:11230166).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0477311 – 41MAGER…RQQQR → MSFRGKVFKREPSEFWKKRR TVRRVNQEEIHRFSS in isoform 3. 1 PublicationAdd BLAST41
Alternative sequenceiVSP_007716565 – 593FKDNQ…ISTED → DSCSQQTRNTFNGGIGSFSF ERFCVAYYF in isoform 2. 1 PublicationAdd BLAST29
Alternative sequenceiVSP_007717594 – 2186Missing in isoform 2. 1 PublicationAdd BLAST1593

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB014594 mRNA Translation: BAA31669.2 Different initiation.
EU236710 mRNA Translation: ABY70713.2
AC011739 Genomic DNA No translation available.
AC017095 Genomic DNA No translation available.
AC093806 Genomic DNA No translation available.
BC015018 mRNA Translation: AAH15018.1 Different initiation.
AK000227 mRNA Translation: BAA91022.1 Frameshift.
AK001253 mRNA Translation: BAA91583.1 Different initiation.
CR749492 mRNA Translation: CAH18316.1 Different initiation.
CCDSiCCDS46528.1 [Q96BY6-1]
CCDS74661.1 [Q96BY6-3]
RefSeqiNP_001277192.1, NM_001290263.1 [Q96BY6-3]
NP_055504.2, NM_014689.2 [Q96BY6-1]
UniGeneiHs.46578

Genome annotation databases

EnsembliENST00000258390; ENSP00000258390; ENSG00000135905 [Q96BY6-1]
ENST00000409592; ENSP00000386694; ENSG00000135905 [Q96BY6-3]
GeneIDi55619
KEGGihsa:55619
UCSCiuc002vob.3 human [Q96BY6-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB014594 mRNA Translation: BAA31669.2 Different initiation.
EU236710 mRNA Translation: ABY70713.2
AC011739 Genomic DNA No translation available.
AC017095 Genomic DNA No translation available.
AC093806 Genomic DNA No translation available.
BC015018 mRNA Translation: AAH15018.1 Different initiation.
AK000227 mRNA Translation: BAA91022.1 Frameshift.
AK001253 mRNA Translation: BAA91583.1 Different initiation.
CR749492 mRNA Translation: CAH18316.1 Different initiation.
CCDSiCCDS46528.1 [Q96BY6-1]
CCDS74661.1 [Q96BY6-3]
RefSeqiNP_001277192.1, NM_001290263.1 [Q96BY6-3]
NP_055504.2, NM_014689.2 [Q96BY6-1]
UniGeneiHs.46578

3D structure databases

ProteinModelPortaliQ96BY6
SMRiQ96BY6
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi120758, 6 interactors
IntActiQ96BY6, 2 interactors
STRINGi9606.ENSP00000258390

PTM databases

iPTMnetiQ96BY6
PhosphoSitePlusiQ96BY6

Polymorphism and mutation databases

BioMutaiDOCK10
DMDMi332278210

Proteomic databases

EPDiQ96BY6
MaxQBiQ96BY6
PaxDbiQ96BY6
PeptideAtlasiQ96BY6
PRIDEiQ96BY6
ProteomicsDBi76127
76128 [Q96BY6-2]

Protocols and materials databases

DNASUi55619
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000258390; ENSP00000258390; ENSG00000135905 [Q96BY6-1]
ENST00000409592; ENSP00000386694; ENSG00000135905 [Q96BY6-3]
GeneIDi55619
KEGGihsa:55619
UCSCiuc002vob.3 human [Q96BY6-1]

Organism-specific databases

CTDi55619
DisGeNETi55619
EuPathDBiHostDB:ENSG00000135905.18
GeneCardsiDOCK10
H-InvDBiHIX0002889
HGNCiHGNC:23479 DOCK10
HPAiHPA058106
MIMi611518 gene
neXtProtiNX_Q96BY6
OpenTargetsiENSG00000135905
PharmGKBiPA134983197
HUGEiSearch...
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG1997 Eukaryota
ENOG410XNVY LUCA
GeneTreeiENSGT00760000119234
HOGENOMiHOG000231373
HOVERGENiHBG107819
InParanoidiQ96BY6
KOiK21853
OMAiNSMMKRV
OrthoDBiEOG091G03FS
PhylomeDBiQ96BY6
TreeFamiTF313629

Enzyme and pathway databases

ReactomeiR-HSA-983231 Factors involved in megakaryocyte development and platelet production

Miscellaneous databases

ChiTaRSiDOCK10 human
GeneWikiiDock10
GenomeRNAii55619
PROiPR:Q96BY6
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000135905 Expressed in 192 organ(s), highest expression level in corpus callosum
CleanExiHS_DOCK10
ExpressionAtlasiQ96BY6 baseline and differential
GenevisibleiQ96BY6 HS

Family and domain databases

CDDicd08697 C2_Dock-D, 1 hit
Gene3Di2.30.29.30, 1 hit
2.60.40.150, 1 hit
InterProiView protein in InterPro
IPR037809 C2_Dock-D
IPR035892 C2_domain_sf
IPR027007 DHR-1_domain
IPR027357 DHR-2
IPR026791 DOCK
IPR010703 DOCK_C
IPR021816 DOCK_C/D_N
IPR011993 PH-like_dom_sf
IPR001849 PH_domain
PANTHERiPTHR23317 PTHR23317, 1 hit
PfamiView protein in Pfam
PF06920 DHR-2, 1 hit
PF14429 DOCK-C2, 1 hit
PF11878 DUF3398, 1 hit
PF00169 PH, 1 hit
SMARTiView protein in SMART
SM00233 PH, 1 hit
PROSITEiView protein in PROSITE
PS51650 DHR_1, 1 hit
PS51651 DHR_2, 1 hit
PS50003 PH_DOMAIN, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiDOC10_HUMAN
AccessioniPrimary (citable) accession number: Q96BY6
Secondary accession number(s): B3FL70
, O75178, Q68DA4, Q9NW06, Q9NXI8
Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 3, 2003
Last sequence update: May 3, 2011
Last modified: November 7, 2018
This is version 154 of the entry and version 3 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again