Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 136 (13 Nov 2019)
Sequence version 1 (01 Dec 2001)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Uracil phosphoribosyltransferase homolog

Gene

UPRT

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Caution

No UPRTase activity has been detected in vitro and the uracil binding region known from UPRTases is missing.1 Publication

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the interaction between a single amino acid and another chemical entity. Priority is given to the annotation of physiological ligands.<p><a href='/help/binding' target='_top'>More...</a></p>Binding sitei133GTPBy similarity1
Binding sitei142GTPBy similarity1
Binding sitei1865-phospho-alpha-D-ribose 1-diphosphateBy similarity1
Binding sitei203GTPBy similarity1
Binding sitei232GTPBy similarity1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes a region in the protein which binds nucleotide phosphates. It always involves more than one amino acid and includes all residues involved in nucleotide-binding.<p><a href='/help/np_bind' target='_top'>More...</a></p>Nucleotide bindingi176 – 179GTPBy similarity4

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

LigandGTP-binding, Nucleotide-binding

Enzyme and pathway databases

BRENDA Comprehensive Enzyme Information System

More...
BRENDAi
2.4.2.9 2681

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Uracil phosphoribosyltransferase homolog
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:UPRT
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome X

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:28334 UPRT

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
300656 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q96BW1

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
139596

Open Targets

More...
OpenTargetsi
ENSG00000094841

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA162408652

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q96BW1

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
UPRT

Domain mapping of disease mutations (DMDM)

More...
DMDMi
74751783

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002545351 – 309Uracil phosphoribosyltransferase homologAdd BLAST309

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei25PhosphoserineBy similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q96BW1

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q96BW1

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q96BW1

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q96BW1

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q96BW1

PeptideAtlas

More...
PeptideAtlasi
Q96BW1

PRoteomics IDEntifications database

More...
PRIDEi
Q96BW1

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
76119 [Q96BW1-1]
76120 [Q96BW1-2]
76121 [Q96BW1-3]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q96BW1

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q96BW1

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Highly expressed in leukocytes, liver, spleen and thymus, with lower expression in brain, lung and skeletal muscle.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000094841 Expressed in 190 organ(s), highest expression level in intestine

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q96BW1 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q96BW1 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA000805

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

WithEntry#Exp.IntActNotes
Q8WU106EBI-742943,EBI-742933

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
126576, 9 interactors

Protein interaction database and analysis system

More...
IntActi
Q96BW1, 17 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000362481

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q96BW1

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni238 – 2465-phospho-alpha-D-ribose 1-diphosphate bindingBy similarity9
Regioni299 – 301Uracil bindingBy similarity3

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the UPRTase family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG4203 Eukaryota
COG0035 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00950000182816

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000262755

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q96BW1

KEGG Orthology (KO)

More...
KOi
K00761

Identification of Orthologs from Complete Genome Data

More...
OMAi
LFCTPMA

Database of Orthologous Groups

More...
OrthoDBi
929897at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q96BW1

TreeFam database of animal gene trees

More...
TreeFami
TF105900

Family and domain databases

Conserved Domains Database

More...
CDDi
cd06223 PRTases_typeI, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
3.40.50.2020, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR000836 PRibTrfase_dom
IPR029057 PRTase-like

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF53271 SSF53271, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q96BW1-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MATELQCPDS MPCHNQQVNS ASTPSPEQLR PGDLILDHAG GNRASRAKVI
60 70 80 90 100
LLTGYAHSSL PAELDSGACG GSSLNSEGNS GSGDSSSYDA PAGNSFLEDC
110 120 130 140 150
ELSRQIGAQL KLLPMNDQIR ELQTIIRDKT ASRGDFMFSA DRLIRLVVEE
160 170 180 190 200
GLNQLPYKEC MVTTPTGYKY EGVKFEKGNC GVSIMRSGEA MEQGLRDCCR
210 220 230 240 250
SIRIGKILIQ SDEETQRAKV YYAKFPPDIY RRKVLLMYPI LSTGNTVIEA
260 270 280 290 300
VKVLIEHGVQ PSVIILLSLF STPHGAKSII QEFPEITILT TEVHPVAPTH

FGQKYFGTD
Length:309
Mass (Da):33,786
Last modified:December 1, 2001 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i5B3E77326345767B
GO
Isoform 2 (identifier: Q96BW1-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     144-176: IRLVVEEGLNQLPYKECMVTTPTGYKYEGVKFE → VLPEDLFQKSIDNSCSAFHHQTCCGRGIESAAI
     177-309: Missing.

Note: No experimental confirmation available.
Show »
Length:176
Mass (Da):18,700
Checksum:i8C467592DB54C2D2
GO
Isoform 3 (identifier: Q96BW1-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-114: Missing.
     276-281: AKSIIQ → EFSMRQ
     282-309: Missing.

Note: No experimental confirmation available.
Show »
Length:167
Mass (Da):19,056
Checksum:i1CF01617F74AC63A
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A0A0MRR5A0A0A0MRR5_HUMAN
Uracil phosphoribosyltransferase ho...
UPRT RP11-311P8.3, hCG_20330
281Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PSD7E9PSD7_HUMAN
Uracil phosphoribosyltransferase ho...
UPRT
173Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8W6E9F8W6E9_HUMAN
Uracil phosphoribosyltransferase ho...
UPRT
142Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A494C0H3A0A494C0H3_HUMAN
Uracil phosphoribosyltransferase ho...
UPRT
149Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti130T → A in CAH18190 (PubMed:17974005).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0212051 – 114Missing in isoform 3. 1 PublicationAdd BLAST114
Alternative sequenceiVSP_021206144 – 176IRLVV…GVKFE → VLPEDLFQKSIDNSCSAFHH QTCCGRGIESAAI in isoform 2. 1 PublicationAdd BLAST33
Alternative sequenceiVSP_021207177 – 309Missing in isoform 2. 1 PublicationAdd BLAST133
Alternative sequenceiVSP_021208276 – 281AKSIIQ → EFSMRQ in isoform 3. 1 Publication6
Alternative sequenceiVSP_021209282 – 309Missing in isoform 3. 1 PublicationAdd BLAST28

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AK056354 mRNA No translation available.
CR749336 mRNA Translation: CAH18190.1
AL137013 Genomic DNA No translation available.
AL590234 Genomic DNA No translation available.
BC015116 mRNA Translation: AAH15116.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS14429.1 [Q96BW1-1]

NCBI Reference Sequences

More...
RefSeqi
NP_659489.1, NM_145052.3 [Q96BW1-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000373383; ENSP00000362481; ENSG00000094841 [Q96BW1-1]
ENST00000462237; ENSP00000433987; ENSG00000094841 [Q96BW1-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
139596

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:139596

UCSC genome browser

More...
UCSCi
uc004ecb.3 human [Q96BW1-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK056354 mRNA No translation available.
CR749336 mRNA Translation: CAH18190.1
AL137013 Genomic DNA No translation available.
AL590234 Genomic DNA No translation available.
BC015116 mRNA Translation: AAH15116.1
CCDSiCCDS14429.1 [Q96BW1-1]
RefSeqiNP_659489.1, NM_145052.3 [Q96BW1-1]

3D structure databases

SMRiQ96BW1
ModBaseiSearch...

Protein-protein interaction databases

BioGridi126576, 9 interactors
IntActiQ96BW1, 17 interactors
STRINGi9606.ENSP00000362481

PTM databases

iPTMnetiQ96BW1
PhosphoSitePlusiQ96BW1

Polymorphism and mutation databases

BioMutaiUPRT
DMDMi74751783

Proteomic databases

EPDiQ96BW1
jPOSTiQ96BW1
MassIVEiQ96BW1
MaxQBiQ96BW1
PaxDbiQ96BW1
PeptideAtlasiQ96BW1
PRIDEiQ96BW1
ProteomicsDBi76119 [Q96BW1-1]
76120 [Q96BW1-2]
76121 [Q96BW1-3]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
139596

Genome annotation databases

EnsembliENST00000373383; ENSP00000362481; ENSG00000094841 [Q96BW1-1]
ENST00000462237; ENSP00000433987; ENSG00000094841 [Q96BW1-2]
GeneIDi139596
KEGGihsa:139596
UCSCiuc004ecb.3 human [Q96BW1-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
139596
DisGeNETi139596

GeneCards: human genes, protein and diseases

More...
GeneCardsi
UPRT
HGNCiHGNC:28334 UPRT
HPAiHPA000805
MIMi300656 gene
neXtProtiNX_Q96BW1
OpenTargetsiENSG00000094841
PharmGKBiPA162408652

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG4203 Eukaryota
COG0035 LUCA
GeneTreeiENSGT00950000182816
HOGENOMiHOG000262755
InParanoidiQ96BW1
KOiK00761
OMAiLFCTPMA
OrthoDBi929897at2759
PhylomeDBiQ96BW1
TreeFamiTF105900

Enzyme and pathway databases

BRENDAi2.4.2.9 2681

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
UPRT human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
139596
PharosiQ96BW1

Protein Ontology

More...
PROi
PR:Q96BW1

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000094841 Expressed in 190 organ(s), highest expression level in intestine
ExpressionAtlasiQ96BW1 baseline and differential
GenevisibleiQ96BW1 HS

Family and domain databases

CDDicd06223 PRTases_typeI, 1 hit
Gene3Di3.40.50.2020, 1 hit
InterProiView protein in InterPro
IPR000836 PRibTrfase_dom
IPR029057 PRTase-like
SUPFAMiSSF53271 SSF53271, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiUPP_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q96BW1
Secondary accession number(s): Q5JRL1
, Q5JRL3, Q68DN0, Q96MW2
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 31, 2006
Last sequence update: December 1, 2001
Last modified: November 13, 2019
This is version 136 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome X
    Human chromosome X: entries, gene names and cross-references to MIM
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again