Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Uracil phosphoribosyltransferase homolog

Gene

UPRT

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Caution

No UPRTase activity has been detected in vitro and the uracil binding region known from UPRTases is missing.1 Publication

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Binding sitei133GTPBy similarity1
Binding sitei142GTPBy similarity1
Binding sitei1865-phospho-alpha-D-ribose 1-diphosphateBy similarity1
Binding sitei203GTPBy similarity1
Binding sitei232GTPBy similarity1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Nucleotide bindingi176 – 179GTPBy similarity4

GO - Molecular functioni

GO - Biological processi

Keywordsi

LigandGTP-binding, Nucleotide-binding

Enzyme and pathway databases

BRENDAi2.4.2.9 2681

Names & Taxonomyi

Protein namesi
Recommended name:
Uracil phosphoribosyltransferase homolog
Gene namesi
Name:UPRT
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome X

Organism-specific databases

EuPathDBiHostDB:ENSG00000094841.13
HGNCiHGNC:28334 UPRT
MIMi300656 gene
neXtProtiNX_Q96BW1

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Nucleus

Pathology & Biotechi

Organism-specific databases

DisGeNETi139596
OpenTargetsiENSG00000094841
PharmGKBiPA162408652

Polymorphism and mutation databases

BioMutaiUPRT
DMDMi74751783

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002545351 – 309Uracil phosphoribosyltransferase homologAdd BLAST309

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei25PhosphoserineBy similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ96BW1
MaxQBiQ96BW1
PaxDbiQ96BW1
PeptideAtlasiQ96BW1
PRIDEiQ96BW1
ProteomicsDBi76119
76120 [Q96BW1-2]
76121 [Q96BW1-3]

PTM databases

iPTMnetiQ96BW1
PhosphoSitePlusiQ96BW1

Expressioni

Tissue specificityi

Highly expressed in leukocytes, liver, spleen and thymus, with lower expression in brain, lung and skeletal muscle.1 Publication

Gene expression databases

BgeeiENSG00000094841 Expressed in 190 organ(s), highest expression level in intestine
CleanExiHS_UPRT
ExpressionAtlasiQ96BW1 baseline and differential
GenevisibleiQ96BW1 HS

Organism-specific databases

HPAiHPA000805

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
PYROXD1Q8WU106EBI-742943,EBI-742933

Protein-protein interaction databases

BioGridi126576, 9 interactors
IntActiQ96BW1, 10 interactors
STRINGi9606.ENSP00000362481

Structurei

3D structure databases

ProteinModelPortaliQ96BW1
SMRiQ96BW1
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni238 – 2465-phospho-alpha-D-ribose 1-diphosphate bindingBy similarity9
Regioni299 – 301Uracil bindingBy similarity3

Sequence similaritiesi

Belongs to the UPRTase family.Curated

Phylogenomic databases

eggNOGiKOG4203 Eukaryota
COG0035 LUCA
GeneTreeiENSGT00510000047272
HOGENOMiHOG000262755
HOVERGENiHBG105296
InParanoidiQ96BW1
KOiK00761
OMAiVVYAKFP
OrthoDBiEOG091G0U75
PhylomeDBiQ96BW1
TreeFamiTF105900

Family and domain databases

CDDicd06223 PRTases_typeI, 1 hit
InterProiView protein in InterPro
IPR000836 PRibTrfase_dom
IPR029057 PRTase-like
SUPFAMiSSF53271 SSF53271, 1 hit

Sequences (3+)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 3 potential isoforms that are computationally mapped.iShow all

Isoform 1 (identifier: Q96BW1-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MATELQCPDS MPCHNQQVNS ASTPSPEQLR PGDLILDHAG GNRASRAKVI
60 70 80 90 100
LLTGYAHSSL PAELDSGACG GSSLNSEGNS GSGDSSSYDA PAGNSFLEDC
110 120 130 140 150
ELSRQIGAQL KLLPMNDQIR ELQTIIRDKT ASRGDFMFSA DRLIRLVVEE
160 170 180 190 200
GLNQLPYKEC MVTTPTGYKY EGVKFEKGNC GVSIMRSGEA MEQGLRDCCR
210 220 230 240 250
SIRIGKILIQ SDEETQRAKV YYAKFPPDIY RRKVLLMYPI LSTGNTVIEA
260 270 280 290 300
VKVLIEHGVQ PSVIILLSLF STPHGAKSII QEFPEITILT TEVHPVAPTH

FGQKYFGTD
Length:309
Mass (Da):33,786
Last modified:December 1, 2001 - v1
Checksum:i5B3E77326345767B
GO
Isoform 2 (identifier: Q96BW1-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     144-176: IRLVVEEGLNQLPYKECMVTTPTGYKYEGVKFE → VLPEDLFQKSIDNSCSAFHHQTCCGRGIESAAI
     177-309: Missing.

Note: No experimental confirmation available.
Show »
Length:176
Mass (Da):18,700
Checksum:i8C467592DB54C2D2
GO
Isoform 3 (identifier: Q96BW1-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-114: Missing.
     276-281: AKSIIQ → EFSMRQ
     282-309: Missing.

Note: No experimental confirmation available.
Show »
Length:167
Mass (Da):19,056
Checksum:i1CF01617F74AC63A
GO

Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A0A0MRR5A0A0A0MRR5_HUMAN
Uracil phosphoribosyltransferase ho...
UPRT RP11-311P8.3, hCG_20330
281Annotation score:
E9PSD7E9PSD7_HUMAN
Uracil phosphoribosyltransferase ho...
UPRT
173Annotation score:
F8W6E9F8W6E9_HUMAN
Uracil phosphoribosyltransferase ho...
UPRT
142Annotation score:

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti130T → A in CAH18190 (PubMed:17974005).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0212051 – 114Missing in isoform 3. 1 PublicationAdd BLAST114
Alternative sequenceiVSP_021206144 – 176IRLVV…GVKFE → VLPEDLFQKSIDNSCSAFHH QTCCGRGIESAAI in isoform 2. 1 PublicationAdd BLAST33
Alternative sequenceiVSP_021207177 – 309Missing in isoform 2. 1 PublicationAdd BLAST133
Alternative sequenceiVSP_021208276 – 281AKSIIQ → EFSMRQ in isoform 3. 1 Publication6
Alternative sequenceiVSP_021209282 – 309Missing in isoform 3. 1 PublicationAdd BLAST28

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK056354 mRNA No translation available.
CR749336 mRNA Translation: CAH18190.1
AL137013 Genomic DNA No translation available.
AL590234 Genomic DNA No translation available.
BC015116 mRNA Translation: AAH15116.1
CCDSiCCDS14429.1 [Q96BW1-1]
RefSeqiNP_659489.1, NM_145052.3 [Q96BW1-1]
UniGeneiHs.91612

Genome annotation databases

EnsembliENST00000373383; ENSP00000362481; ENSG00000094841 [Q96BW1-1]
ENST00000462237; ENSP00000433987; ENSG00000094841 [Q96BW1-2]
GeneIDi139596
KEGGihsa:139596
UCSCiuc004ecb.3 human [Q96BW1-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiUPP_HUMAN
AccessioniPrimary (citable) accession number: Q96BW1
Secondary accession number(s): Q5JRL1
, Q5JRL3, Q68DN0, Q96MW2
Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 31, 2006
Last sequence update: December 1, 2001
Last modified: September 12, 2018
This is version 127 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again