Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Protein FAM149B1

Gene

FAM149B1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at transcript leveli

Names & Taxonomyi

Protein namesi
Recommended name:
Protein FAM149B1
Gene namesi
Name:FAM149B1
Synonyms:KIAA0974
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 10

Organism-specific databases

EuPathDBiHostDB:ENSG00000138286.14
HGNCiHGNC:29162 FAM149B1
neXtProtiNX_Q96BN6

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000138286
PharmGKBiPA162386399

Polymorphism and mutation databases

BioMutaiFAM149B1
DMDMi182676632

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00003199331 – 582Protein FAM149B1Add BLAST582

Proteomic databases

PaxDbiQ96BN6
PeptideAtlasiQ96BN6
PRIDEiQ96BN6
ProteomicsDBi76092
76093 [Q96BN6-2]

PTM databases

iPTMnetiQ96BN6
PhosphoSitePlusiQ96BN6

Expressioni

Gene expression databases

BgeeiENSG00000138286
CleanExiHS_FAM149B1
ExpressionAtlasiQ96BN6 baseline and differential
GenevisibleiQ96BN6 HS

Organism-specific databases

HPAiHPA039189
HPA039859

Interactioni

Protein-protein interaction databases

BioGridi130429, 2 interactors
STRINGi9606.ENSP00000242505

Structurei

3D structure databases

ProteinModelPortaliQ96BN6
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the FAM149 family.Curated

Phylogenomic databases

eggNOGiENOG410IE96 Eukaryota
ENOG410ZYXN LUCA
GeneTreeiENSGT00530000063727
HOGENOMiHOG000065676
HOVERGENiHBG107888
InParanoidiQ96BN6
OMAiCAVEYPH
OrthoDBiEOG091G05T8
PhylomeDBiQ96BN6
TreeFamiTF330725

Family and domain databases

InterProiView protein in InterPro
IPR022194 DUF3719
PfamiView protein in Pfam
PF12516 DUF3719, 1 hit

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q96BN6-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MISRYTRKAV PQSLELKGIT KHALNHHPPP EKLEEISPTS DSHEKDTSSQ
60 70 80 90 100
SKSDITRESS FTSADTGNSL SAFPSYTGAG ISTEGSSDFS WGYGELDQNA
110 120 130 140 150
TEKVQTMFTA IDELLYEQKL SVHTKSLQEE CQQWTASFPH LRILGRQIIT
160 170 180 190 200
PSEGYRLYPR SPSAVSASYE TTLSQERDST IFGIRGKKLH FSSSYAHKAS
210 220 230 240 250
SIAKSSSFCS MERDEEDSII VSEGIIEEYL AFDHIDIEEG FHGKKSEAAT
260 270 280 290 300
EKQKLGYPPI APFYCMKEDV LAYVFDSVWC KVVSCMEQLT RSHWEGFASD
310 320 330 340 350
DESNVAVTRP DSESSCVLSE LHPLVLPRVP QSKVLYITSN PMSLCQASRH
360 370 380 390 400
QPNVNDLLVH GMPLQPRNLS LMDKLLDLDD KLLMRPGSST ILSTRNWPNR
410 420 430 440 450
AVEFSTSSLS YTVQSTRRRN PPPRTLHPIS TSHSCAETPR SVEEILRGAR
460 470 480 490 500
VPVAPDSLSS PSPTPLSRNN LLPPIGTAEV EHVSTVGPQR QMKPHGDSSR
510 520 530 540 550
AQSAVVDEPN YQQPQERLLL PDFFPRPNTT QSFLLDTQYR RSCAVEYPHQ
560 570 580
ARPGRGSAGP QLHGSTKSQS GGRPVSRTRQ GP
Length:582
Mass (Da):64,618
Last modified:February 26, 2008 - v2
Checksum:i5DA856203C1A26B7
GO
Isoform 2 (identifier: Q96BN6-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     334-341: Missing.
     535-582: LDTQYRRSCAVEYPHQARPGRGSAGPQLHGSTKSQSGGRPVSRTRQGP → VE

Note: No experimental confirmation available.
Show »
Length:528
Mass (Da):58,800
Checksum:i307FE2DF16034F61
GO

Sequence cautioni

The sequence AAH15394 differs from that shown. Reason: Erroneous initiation.Curated

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_060167571G → R. Corresponds to variant dbSNP:rs12573841Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_031533334 – 341Missing in isoform 2. 1 Publication8
Alternative sequenceiVSP_031534535 – 582LDTQY…TRQGP → VE in isoform 2. 1 PublicationAdd BLAST48

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AC016394 Genomic DNA No translation available.
AB023191 mRNA Translation: BAA76818.1
BC015394 mRNA Translation: AAH15394.1 Different initiation.
CCDSiCCDS44435.1 [Q96BN6-1]
RefSeqiNP_775483.1, NM_173348.1 [Q96BN6-1]
UniGeneiHs.408577

Genome annotation databases

EnsembliENST00000242505; ENSP00000242505; ENSG00000138286 [Q96BN6-1]
GeneIDi317662
KEGGihsa:317662
UCSCiuc009xqz.4 human [Q96BN6-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiF149B_HUMAN
AccessioniPrimary (citable) accession number: Q96BN6
Secondary accession number(s): Q9Y2I0
Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 26, 2008
Last sequence update: February 26, 2008
Last modified: June 20, 2018
This is version 100 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 10
    Human chromosome 10: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. SIMILARITY comments
    Index of protein domains and families

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health