Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 150 (12 Aug 2020)
Sequence version 3 (26 May 2009)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Engulfment and cell motility protein 3

Gene

ELMO3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Involved in cytoskeletal rearrangements required for phagocytosis of apoptotic cells and cell motility. Acts in association with DOCK1 and CRK. Was initially proposed to be required in complex with DOCK1 to activate Rac Rho small GTPases. May enhance the guanine nucleotide exchange factor (GEF) activity of DOCK1 (By similarity).By similarity

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processApoptosis, Phagocytosis

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...
PathwayCommonsi
Q96BJ8

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Engulfment and cell motility protein 3
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:ELMO3
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 16

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000102890.14

Human Gene Nomenclature Database

More...
HGNCi
HGNC:17289, ELMO3

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
606422, gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q96BJ8

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Keywords - Cellular componenti

Cytoplasm

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
79767

Open Targets

More...
OpenTargetsi
ENSG00000102890

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA27756

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q96BJ8, Tbio

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
ELMO3

Domain mapping of disease mutations (DMDM)

More...
DMDMi
238054390

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001537161 – 720Engulfment and cell motility protein 3Add BLAST720

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q96BJ8

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q96BJ8

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q96BJ8

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q96BJ8

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q96BJ8

PeptideAtlas

More...
PeptideAtlasi
Q96BJ8

PRoteomics IDEntifications database

More...
PRIDEi
Q96BJ8

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
76083 [Q96BJ8-1]
76084 [Q96BJ8-2]
76085 [Q96BJ8-3]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q96BJ8

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q96BJ8

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000102890, Expressed in adenohypophysis and 156 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q96BJ8, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q96BJ8, HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000102890, Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Probably interacts directly with the SH3-domain of DOCK1 via its SH3-binding site.

Part of a complex with DOCK1 and RAC1 (By similarity).

Interacts with ADGRB3 (PubMed:24567399).

By similarity1 Publication

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
122872, 22 interactors

Protein interaction database and analysis system

More...
IntActi
Q96BJ8, 23 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000377566

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q96BJ8, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q96BJ8

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini307 – 479ELMOPROSITE-ProRule annotationAdd BLAST173
Domaini542 – 664PHAdd BLAST123

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi696 – 706SH3-bindingAdd BLAST11

Keywords - Domaini

SH3-binding

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG2999, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000159455

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_023887_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q96BJ8

KEGG Orthology (KO)

More...
KOi
K19241

Identification of Orthologs from Complete Genome Data

More...
OMAi
VEEYCLN

Database of Orthologous Groups

More...
OrthoDBi
234725at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q96BJ8

TreeFam database of animal gene trees

More...
TreeFami
TF312966

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
2.30.29.30, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR016024, ARM-type_fold
IPR024574, DUF3361
IPR030719, ELMO3
IPR006816, ELMO_dom
IPR011993, PH-like_dom_sf
IPR001849, PH_domain

The PANTHER Classification System

More...
PANTHERi
PTHR12771:SF16, PTHR12771:SF16, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF11841, DUF3361, 1 hit
PF04727, ELMO_CED12, 1 hit
PF16457, PH_12, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF48371, SSF48371, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS51335, ELMO, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 2 (identifier: Q96BJ8-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAPPRNVVKI AIKMRDAIPQ LIQLDQAKPL AAVLKEVCDA WSLTHSERYA
60 70 80 90 100
LQFADGHRRY ITENNRAEIK NGSILCLSTA PDLEAEQLLG GLQSNSPEGR
110 120 130 140 150
REALRRLVPL ASDMIFAREV ISRNGLQILG TIIEDGDDLG EVLALSLRAF
160 170 180 190 200
SELMEHGVVS WETLSIPFVR KVVCYVNMNL MDASVPPLAL GLLESVTLSS
210 220 230 240 250
PALGQLVKSE VPLDRLLVHL QVMNQQLQTK AMALLTALLQ GASPVERKHM
260 270 280 290 300
LDYLWQRNLR QFIYKNIIHS AAPMGDEMAH HLYVLQALML GLLEPRMRTP
310 320 330 340 350
LDPYSQEQRE QLQVLRQAAF EVEGESSGAG LSADRRRSLC AREFRKLGFS
360 370 380 390 400
NSNPAQDLER VPPGLLALDN MLYFSRNAPS AYSRFVLENS SREDKHECPF
410 420 430 440 450
ARGSIQLTVL LCELLRVGEP CSETAQDFSP MFFGQDQSFH ELFCVGIQLL
460 470 480 490 500
NKTWKEMRAT QEDFDKVMQV VREQLARTLA LKPTSLELFR TKVNALTYGE
510 520 530 540 550
VLRLRQTERL HQEGTLAPPI LELREKLKPE LMGLIRQQRL LRLCEGTLFR
560 570 580 590 600
KISSRRRQDK LWFCCLSPNH KLLQYGDMEE GASPPTLESL PEQLPVADMR
610 620 630 640 650
ALLTGKDCPH VREKGSGKQN KDLYELAFSI SYDRGEEEAY LNFIAPSKRE
660 670 680 690 700
FYLWTDGLSA LLGSPMGSEQ TRLDLEQLLT METKLRLLEL ENVPIPERPP
710 720
PVPPPPTNFN FCYDCSIAEP
Length:720
Mass (Da):81,467
Last modified:May 26, 2009 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iD8D81291B059618D
GO
Isoform 1 (identifier: Q96BJ8-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-113: Missing.

Show »
Length:607
Mass (Da):68,941
Checksum:iEFE9C8DBD7CB453B
GO
Isoform 3 (identifier: Q96BJ8-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MARSSSLGRECGTPRSGLGKGGPPRPQGPQARCTLGRRCTVSGKCRRPRPSWTM

Show »
Length:773
Mass (Da):87,102
Checksum:i901829EC2C3BD0B7
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
F8W9E7F8W9E7_HUMAN
Engulfment and cell motility protei...
ELMO3
703Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
I3L4D1I3L4D1_HUMAN
Engulfment and cell motility protei...
ELMO3
42Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti65N → S in BAG62598 (PubMed:14702039).Curated1
Sequence conflicti555R → Q in BAG62598 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_05540213K → Q1 PublicationCorresponds to variant dbSNP:rs12923138Ensembl.1
Natural variantiVAR_05540395N → D. Corresponds to variant dbSNP:rs8058861Ensembl.1
Natural variantiVAR_055404316R → C. Corresponds to variant dbSNP:rs33948247Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0373411 – 113Missing in isoform 1. 2 PublicationsAdd BLAST113
Alternative sequenceiVSP_0373421M → MARSSSLGRECGTPRSGLGK GGPPRPQGPQARCTLGRRCT VSGKCRRPRPSWTM in isoform 3. 1 Publication1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AK300976 mRNA Translation: BAG62598.1
AK023886 mRNA Translation: BAB14712.1
AC040160 Genomic DNA No translation available.
BC015524 mRNA Translation: AAH15524.1
BC034410 mRNA Translation: AAH34410.2

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS10833.2 [Q96BJ8-1]

NCBI Reference Sequences

More...
RefSeqi
NP_078988.2, NM_024712.3 [Q96BJ8-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000393997; ENSP00000377566; ENSG00000102890 [Q96BJ8-1]
ENST00000477898; ENSP00000458539; ENSG00000102890 [Q96BJ8-2]
ENST00000652269; ENSP00000498602; ENSG00000102890 [Q96BJ8-3]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
79767

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:79767

UCSC genome browser

More...
UCSCi
uc002esa.4, human [Q96BJ8-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK300976 mRNA Translation: BAG62598.1
AK023886 mRNA Translation: BAB14712.1
AC040160 Genomic DNA No translation available.
BC015524 mRNA Translation: AAH15524.1
BC034410 mRNA Translation: AAH34410.2
CCDSiCCDS10833.2 [Q96BJ8-1]
RefSeqiNP_078988.2, NM_024712.3 [Q96BJ8-1]

3D structure databases

SMRiQ96BJ8
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi122872, 22 interactors
IntActiQ96BJ8, 23 interactors
STRINGi9606.ENSP00000377566

PTM databases

iPTMnetiQ96BJ8
PhosphoSitePlusiQ96BJ8

Polymorphism and mutation databases

BioMutaiELMO3
DMDMi238054390

Proteomic databases

EPDiQ96BJ8
jPOSTiQ96BJ8
MassIVEiQ96BJ8
MaxQBiQ96BJ8
PaxDbiQ96BJ8
PeptideAtlasiQ96BJ8
PRIDEiQ96BJ8
ProteomicsDBi76083 [Q96BJ8-1]
76084 [Q96BJ8-2]
76085 [Q96BJ8-3]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
15666, 200 antibodies

The DNASU plasmid repository

More...
DNASUi
79767

Genome annotation databases

EnsembliENST00000393997; ENSP00000377566; ENSG00000102890 [Q96BJ8-1]
ENST00000477898; ENSP00000458539; ENSG00000102890 [Q96BJ8-2]
ENST00000652269; ENSP00000498602; ENSG00000102890 [Q96BJ8-3]
GeneIDi79767
KEGGihsa:79767
UCSCiuc002esa.4, human [Q96BJ8-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
79767
DisGeNETi79767
EuPathDBiHostDB:ENSG00000102890.14

GeneCards: human genes, protein and diseases

More...
GeneCardsi
ELMO3
HGNCiHGNC:17289, ELMO3
HPAiENSG00000102890, Low tissue specificity
MIMi606422, gene
neXtProtiNX_Q96BJ8
OpenTargetsiENSG00000102890
PharmGKBiPA27756

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG2999, Eukaryota
GeneTreeiENSGT00940000159455
HOGENOMiCLU_023887_0_0_1
InParanoidiQ96BJ8
KOiK19241
OMAiVEEYCLN
OrthoDBi234725at2759
PhylomeDBiQ96BJ8
TreeFamiTF312966

Enzyme and pathway databases

PathwayCommonsiQ96BJ8

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
79767, 8 hits in 870 CRISPR screens

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
79767
PharosiQ96BJ8, Tbio

Protein Ontology

More...
PROi
PR:Q96BJ8
RNActiQ96BJ8, protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000102890, Expressed in adenohypophysis and 156 other tissues
ExpressionAtlasiQ96BJ8, baseline and differential
GenevisibleiQ96BJ8, HS

Family and domain databases

Gene3Di2.30.29.30, 1 hit
InterProiView protein in InterPro
IPR016024, ARM-type_fold
IPR024574, DUF3361
IPR030719, ELMO3
IPR006816, ELMO_dom
IPR011993, PH-like_dom_sf
IPR001849, PH_domain
PANTHERiPTHR12771:SF16, PTHR12771:SF16, 1 hit
PfamiView protein in Pfam
PF11841, DUF3361, 1 hit
PF04727, ELMO_CED12, 1 hit
PF16457, PH_12, 1 hit
SUPFAMiSSF48371, SSF48371, 1 hit
PROSITEiView protein in PROSITE
PS51335, ELMO, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiELMO3_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q96BJ8
Secondary accession number(s): B4DV86, Q9H8A5
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 16, 2003
Last sequence update: May 26, 2009
Last modified: August 12, 2020
This is version 150 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human chromosome 16
    Human chromosome 16: entries, gene names and cross-references to MIM
  2. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  4. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again