Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Solute carrier organic anion transporter family member 4A1

Gene

SLCO4A1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Mediates the Na+-independent transport of organic anions such as the thyroid hormones T3 (triiodo-L-thyronine), T4 (thyroxine) and rT3, and of estrone-3-sulfate and taurocholate.

GO - Molecular functioni

GO - Biological processi

Keywordsi

Biological processIon transport, Transport

Enzyme and pathway databases

ReactomeiR-HSA-879518 Transport of organic anions

Protein family/group databases

MEROPSiI01.972
TCDBi2.A.60.1.9 the organo anion transporter (oat) family

Names & Taxonomyi

Protein namesi
Recommended name:
Solute carrier organic anion transporter family member 4A1
Short name:
OATP4A1
Alternative name(s):
Colon organic anion transporter
Organic anion transporter polypeptide-related protein 1
Short name:
OATP-RP1
Short name:
OATPRP1
Short name:
POAT
Organic anion-transporting polypeptide E
Short name:
OATP-E
Sodium-independent organic anion transporter E
Solute carrier family 21 member 12
Gene namesi
Name:SLCO4A1
Synonyms:OATP1, OATP4A1, OATPE, SLC21A12
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 20

Organism-specific databases

EuPathDBiHostDB:ENSG00000101187.15
HGNCiHGNC:10953 SLCO4A1
MIMi612436 gene
neXtProtiNX_Q96BD0

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini1 – 103CytoplasmicSequence analysisAdd BLAST103
Transmembranei104 – 124Helical; Name=1Sequence analysisAdd BLAST21
Topological domaini125 – 143ExtracellularSequence analysisAdd BLAST19
Transmembranei144 – 164Helical; Name=2Sequence analysisAdd BLAST21
Topological domaini165 – 170CytoplasmicSequence analysis6
Transmembranei171 – 195Helical; Name=3Sequence analysisAdd BLAST25
Topological domaini196 – 222ExtracellularSequence analysisAdd BLAST27
Transmembranei223 – 253Helical; Name=4Sequence analysisAdd BLAST31
Topological domaini254 – 272CytoplasmicSequence analysisAdd BLAST19
Transmembranei273 – 293Helical; Name=5Sequence analysisAdd BLAST21
Topological domaini294 – 307ExtracellularSequence analysisAdd BLAST14
Transmembranei308 – 332Helical; Name=6Sequence analysisAdd BLAST25
Topological domaini333 – 378CytoplasmicSequence analysisAdd BLAST46
Transmembranei379 – 400Helical; Name=7Sequence analysisAdd BLAST22
Topological domaini401 – 420ExtracellularSequence analysisAdd BLAST20
Transmembranei421 – 444Helical; Name=8Sequence analysisAdd BLAST24
Topological domaini445 – 448CytoplasmicSequence analysis4
Transmembranei449 – 471Helical; Name=9Sequence analysisAdd BLAST23
Topological domaini472 – 580ExtracellularSequence analysisAdd BLAST109
Transmembranei581 – 603Helical; Name=10Sequence analysisAdd BLAST23
Topological domaini604 – 612CytoplasmicSequence analysis9
Transmembranei613 – 638Helical; Name=11Sequence analysisAdd BLAST26
Topological domaini639 – 671ExtracellularSequence analysisAdd BLAST33
Transmembranei672 – 689Helical; Name=12Sequence analysisAdd BLAST18
Topological domaini690 – 722CytoplasmicSequence analysisAdd BLAST33

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Organism-specific databases

DisGeNETi28231
OpenTargetsiENSG00000101187
PharmGKBiPA35838

Chemistry databases

ChEMBLiCHEMBL2073679
DrugBankiDB01053 Benzylpenicillin
DB00286 Conjugated Equine Estrogens
DB00509 Dextrothyroxine
DB00390 Digoxin
DB00917 Dinoprostone
DB00783 Estradiol
DB00451 Levothyroxine
DB00279 Liothyronine
DB01583 Liotrix
DB04348 Taurocholic Acid

Polymorphism and mutation databases

BioMutaiSLCO4A1
DMDMi27734555

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001910671 – 722Solute carrier organic anion transporter family member 4A1Add BLAST722

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei34PhosphoserineCombined sources1
Modified residuei37PhosphothreonineCombined sources1
Modified residuei40PhosphoserineCombined sources1
Modified residuei43PhosphoserineCombined sources1
Modified residuei46PhosphoserineCombined sources1
Modified residuei50PhosphoserineCombined sources1
Glycosylationi499N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi504 ↔ 530PROSITE-ProRule annotation
Disulfide bondi508 ↔ 519PROSITE-ProRule annotation
Disulfide bondi510 ↔ 534PROSITE-ProRule annotation
Glycosylationi557N-linked (GlcNAc...) asparagineSequence analysis1

Keywords - PTMi

Disulfide bond, Glycoprotein, Phosphoprotein

Proteomic databases

MaxQBiQ96BD0
PaxDbiQ96BD0
PeptideAtlasiQ96BD0
PRIDEiQ96BD0
ProteomicsDBi76061
76062 [Q96BD0-2]
76063 [Q96BD0-3]
76064 [Q96BD0-4]

PTM databases

iPTMnetiQ96BD0
PhosphoSitePlusiQ96BD0
SwissPalmiQ96BD0

Expressioni

Tissue specificityi

Ubiquitous, with the exception of spleen and leukocytes.

Gene expression databases

BgeeiENSG00000101187 Expressed in 182 organ(s), highest expression level in right lung
CleanExiHS_SLCO4A1
ExpressionAtlasiQ96BD0 baseline and differential
GenevisibleiQ96BD0 HS

Organism-specific databases

HPAiHPA030669
HPA030670

Interactioni

Protein-protein interaction databases

BioGridi118180, 4 interactors
IntActiQ96BD0, 6 interactors
STRINGi9606.ENSP00000217159

Structurei

3D structure databases

ProteinModelPortaliQ96BD0
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini498 – 555Kazal-likePROSITE-ProRule annotationAdd BLAST58

Sequence similaritiesi

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG3626 Eukaryota
ENOG410XRSF LUCA
GeneTreeiENSGT00760000119014
HOVERGENiHBG100565
InParanoidiQ96BD0
KOiK14354
OMAiKVWIGAW
OrthoDBiEOG091G02FX
PhylomeDBiQ96BD0
TreeFamiTF317540

Family and domain databases

CDDicd06174 MFS, 1 hit
InterProiView protein in InterPro
IPR002350 Kazal_dom
IPR036058 Kazal_dom_sf
IPR020846 MFS_dom
IPR036259 MFS_trans_sf
IPR004156 OATP
PANTHERiPTHR11388 PTHR11388, 1 hit
PfamiView protein in Pfam
PF07648 Kazal_2, 1 hit
PF03137 OATP, 1 hit
SUPFAMiSSF100895 SSF100895, 1 hit
SSF103473 SSF103473, 1 hit
TIGRFAMsiTIGR00805 oat, 1 hit
PROSITEiView protein in PROSITE
PS51465 KAZAL_2, 1 hit
PS50850 MFS, 1 hit

Sequences (4+)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket
Note: Experimental confirmation may be lacking for some isoforms.

This entry has 4 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q96BD0-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MPLHQLGDKP LTFPSPNSAM ENGLDHTPPS RRASPGTPLS PGSLRSAAHS
60 70 80 90 100
PLDTSKQPLC QLWAEKHGAR GTHEVRYVSA GQSVACGWWA FAPPCLQVLN
110 120 130 140 150
TPKGILFFLC AAAFLQGMTV NGFINTVITS LERRYDLHSY QSGLIASSYD
160 170 180 190 200
IAACLCLTFV SYFGGSGHKP RWLGWGVLLM GTGSLVFALP HFTAGRYEVE
210 220 230 240 250
LDAGVRTCPA NPGAVCADST SGLSRYQLVF MLGQFLHGVG ATPLYTLGVT
260 270 280 290 300
YLDENVKSSC SPVYIAIFYT AAILGPAAGY LIGGALLNIY TEMGRRTELT
310 320 330 340 350
TESPLWVGAW WVGFLGSGAA AFFTAVPILG YPRQLPGSQR YAVMRAAEMH
360 370 380 390 400
QLKDSSRGEA SNPDFGKTIR DLPLSIWLLL KNPTFILLCL AGATEATLIT
410 420 430 440 450
GMSTFSPKFL ESQFSLSASE AATLFGYLVV PAGGGGTFLG GFFVNKLRLR
460 470 480 490 500
GSAVIKFCLF CTVVSLLGIL VFSLHCPSVP MAGVTASYGG SLLPEGHLNL
510 520 530 540 550
TAPCNAACSC QPEHYSPVCG SDGLMYFSLC HAGCPAATET NVDGQKVYRD
560 570 580 590 600
CSCIPQNLSS GFGHATAGKC TSTCQRKPLL LVFIFVVIFF TFLSSIPALT
610 620 630 640 650
ATLRCVRDPQ RSFALGIQWI VVRILGGIPG PIAFGWVIDK ACLLWQDQCG
660 670 680 690 700
QQGSCLVYQN SAMSRYILIM GLLYKVLGVL FFAIACFLYK PLSESSDGLE
710 720
TCLPSQSSAP DSATDSQLQS SV
Length:722
Mass (Da):77,193
Last modified:January 10, 2003 - v2
Checksum:iDD8F0C10E4BCD255
GO
Isoform 2 (identifier: Q96BD0-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     250-410: TYLDENVKSS...GMSTFSPKFL → LFFAIACFLYKPLS
     686-722: CFLYKPLSES...ATDSQLQSSV → SSRAASDHRP...ELLFDLQPST

Show »
Length:583
Mass (Da):62,325
Checksum:i67342B00D99DCB31
GO
Isoform 3 (identifier: Q96BD0-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     548-661: YRDCSCIPQN...QGSCLVYQNS → SGAAAYRPCP...QHPEAELCRS
     662-722: Missing.

Show »
Length:661
Mass (Da):70,454
Checksum:i39E50AB1FC24B071
GO
Isoform 4 (identifier: Q96BD0-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     572-603: STCQRKPLLLVFIFVVIFFTFLSSIPALTATL → TTALCAARTASCTSHCATQGALQPRRRMWTAR

Show »
Length:722
Mass (Da):77,084
Checksum:i8A5B9415E0B1CB63
GO

Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E1P5H9E1P5H9_HUMAN
Solute carrier organic anion transp...
SLCO4A1 hCG_1748044
620Annotation score:
A0A0A0MT51A0A0A0MT51_HUMAN
Solute carrier organic anion transp...
SLCO4A1
151Annotation score:

Sequence cautioni

The sequence BAA91247 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti246T → M in BAB14566 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_05367870R → Q. Corresponds to variant dbSNP:rs34419428Ensembl.1
Natural variantiVAR_05367978V → I1 PublicationCorresponds to variant dbSNP:rs1047099Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_006152250 – 410TYLDE…SPKFL → LFFAIACFLYKPLS in isoform 2. 1 PublicationAdd BLAST161
Alternative sequenceiVSP_006153548 – 661YRDCS…VYQNS → SGAAAYRPCPPLDPGKGPPC LPLVIGAIVGLPRCTETVAV SLRIFPLVLAMHCREMHFNL SEKAPPSGFHIRCNFLYIPQ QHSCTNGNSTVSWGRVCACP ELSLQHPEAELCRS in isoform 3. CuratedAdd BLAST114
Alternative sequenceiVSP_006154572 – 603STCQR…LTATL → TTALCAARTASCTSHCATQG ALQPRRRMWTAR in isoform 4. 1 PublicationAdd BLAST32
Alternative sequenceiVSP_006155662 – 722Missing in isoform 3. CuratedAdd BLAST61
Alternative sequenceiVSP_006156686 – 722CFLYK…LQSSV → SSRAASDHRPRPPGHGGHSA FPDDRTVPLGDAITRELLFD LQPST in isoform 2. 1 PublicationAdd BLAST37

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB031051 mRNA Translation: BAA89288.1
AF187817 mRNA Translation: AAG43447.1
AF104334 mRNA Translation: AAF15545.1
AF205072 mRNA Translation: AAG42204.1
AK023410 mRNA Translation: BAB14566.1
AK000551 mRNA Translation: BAA91247.1 Different initiation.
AL357033 Genomic DNA No translation available.
BC015727 mRNA Translation: AAH15727.1
CCDSiCCDS13501.1 [Q96BD0-1]
RefSeqiNP_057438.3, NM_016354.3 [Q96BD0-1]
UniGeneiHs.235782

Genome annotation databases

EnsembliENST00000217159; ENSP00000217159; ENSG00000101187 [Q96BD0-1]
ENST00000370507; ENSP00000359538; ENSG00000101187 [Q96BD0-1]
GeneIDi28231
KEGGihsa:28231
UCSCiuc002ydb.1 human [Q96BD0-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB031051 mRNA Translation: BAA89288.1
AF187817 mRNA Translation: AAG43447.1
AF104334 mRNA Translation: AAF15545.1
AF205072 mRNA Translation: AAG42204.1
AK023410 mRNA Translation: BAB14566.1
AK000551 mRNA Translation: BAA91247.1 Different initiation.
AL357033 Genomic DNA No translation available.
BC015727 mRNA Translation: AAH15727.1
CCDSiCCDS13501.1 [Q96BD0-1]
RefSeqiNP_057438.3, NM_016354.3 [Q96BD0-1]
UniGeneiHs.235782

3D structure databases

ProteinModelPortaliQ96BD0
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi118180, 4 interactors
IntActiQ96BD0, 6 interactors
STRINGi9606.ENSP00000217159

Chemistry databases

ChEMBLiCHEMBL2073679
DrugBankiDB01053 Benzylpenicillin
DB00286 Conjugated Equine Estrogens
DB00509 Dextrothyroxine
DB00390 Digoxin
DB00917 Dinoprostone
DB00783 Estradiol
DB00451 Levothyroxine
DB00279 Liothyronine
DB01583 Liotrix
DB04348 Taurocholic Acid

Protein family/group databases

MEROPSiI01.972
TCDBi2.A.60.1.9 the organo anion transporter (oat) family

PTM databases

iPTMnetiQ96BD0
PhosphoSitePlusiQ96BD0
SwissPalmiQ96BD0

Polymorphism and mutation databases

BioMutaiSLCO4A1
DMDMi27734555

Proteomic databases

MaxQBiQ96BD0
PaxDbiQ96BD0
PeptideAtlasiQ96BD0
PRIDEiQ96BD0
ProteomicsDBi76061
76062 [Q96BD0-2]
76063 [Q96BD0-3]
76064 [Q96BD0-4]

Protocols and materials databases

DNASUi28231
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000217159; ENSP00000217159; ENSG00000101187 [Q96BD0-1]
ENST00000370507; ENSP00000359538; ENSG00000101187 [Q96BD0-1]
GeneIDi28231
KEGGihsa:28231
UCSCiuc002ydb.1 human [Q96BD0-1]

Organism-specific databases

CTDi28231
DisGeNETi28231
EuPathDBiHostDB:ENSG00000101187.15
GeneCardsiSLCO4A1
H-InvDBiHIX0015985
HIX0138058
HGNCiHGNC:10953 SLCO4A1
HPAiHPA030669
HPA030670
MIMi612436 gene
neXtProtiNX_Q96BD0
OpenTargetsiENSG00000101187
PharmGKBiPA35838
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG3626 Eukaryota
ENOG410XRSF LUCA
GeneTreeiENSGT00760000119014
HOVERGENiHBG100565
InParanoidiQ96BD0
KOiK14354
OMAiKVWIGAW
OrthoDBiEOG091G02FX
PhylomeDBiQ96BD0
TreeFamiTF317540

Enzyme and pathway databases

ReactomeiR-HSA-879518 Transport of organic anions

Miscellaneous databases

ChiTaRSiSLCO4A1 human
GeneWikiiSLCO4A1
GenomeRNAii28231
PROiPR:Q96BD0
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000101187 Expressed in 182 organ(s), highest expression level in right lung
CleanExiHS_SLCO4A1
ExpressionAtlasiQ96BD0 baseline and differential
GenevisibleiQ96BD0 HS

Family and domain databases

CDDicd06174 MFS, 1 hit
InterProiView protein in InterPro
IPR002350 Kazal_dom
IPR036058 Kazal_dom_sf
IPR020846 MFS_dom
IPR036259 MFS_trans_sf
IPR004156 OATP
PANTHERiPTHR11388 PTHR11388, 1 hit
PfamiView protein in Pfam
PF07648 Kazal_2, 1 hit
PF03137 OATP, 1 hit
SUPFAMiSSF100895 SSF100895, 1 hit
SSF103473 SSF103473, 1 hit
TIGRFAMsiTIGR00805 oat, 1 hit
PROSITEiView protein in PROSITE
PS51465 KAZAL_2, 1 hit
PS50850 MFS, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiSO4A1_HUMAN
AccessioniPrimary (citable) accession number: Q96BD0
Secondary accession number(s): Q9H4T7
, Q9H4T8, Q9H8P2, Q9NWX8, Q9UI35, Q9UIG7
Entry historyiIntegrated into UniProtKB/Swiss-Prot: January 10, 2003
Last sequence update: January 10, 2003
Last modified: November 7, 2018
This is version 157 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. Human chromosome 20
    Human chromosome 20: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again