Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 162 (08 May 2019)
Sequence version 2 (10 Jan 2003)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Solute carrier organic anion transporter family member 4A1

Gene

SLCO4A1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Mediates the Na+-independent transport of organic anions such as the thyroid hormones T3 (triiodo-L-thyronine), T4 (thyroxine) and rT3, and of estrone-3-sulfate and taurocholate.

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processIon transport, Transport

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-879518 Transport of organic anions

Protein family/group databases

MEROPS protease database

More...
MEROPSi
I01.972

Transport Classification Database

More...
TCDBi
2.A.60.1.9 the organo anion transporter (oat) family

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Solute carrier organic anion transporter family member 4A1
Short name:
OATP4A1
Alternative name(s):
Colon organic anion transporter
Organic anion transporter polypeptide-related protein 1
Short name:
OATP-RP1
Short name:
OATPRP1
Short name:
POAT
Organic anion-transporting polypeptide E
Short name:
OATP-E
Sodium-independent organic anion transporter E
Solute carrier family 21 member 12
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:SLCO4A1
Synonyms:OATP1, OATP4A1, OATPE, SLC21A12
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 20

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:10953 SLCO4A1

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
612436 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q96BD0

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini1 – 103CytoplasmicSequence analysisAdd BLAST103
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei104 – 124Helical; Name=1Sequence analysisAdd BLAST21
Topological domaini125 – 143ExtracellularSequence analysisAdd BLAST19
Transmembranei144 – 164Helical; Name=2Sequence analysisAdd BLAST21
Topological domaini165 – 170CytoplasmicSequence analysis6
Transmembranei171 – 195Helical; Name=3Sequence analysisAdd BLAST25
Topological domaini196 – 222ExtracellularSequence analysisAdd BLAST27
Transmembranei223 – 253Helical; Name=4Sequence analysisAdd BLAST31
Topological domaini254 – 272CytoplasmicSequence analysisAdd BLAST19
Transmembranei273 – 293Helical; Name=5Sequence analysisAdd BLAST21
Topological domaini294 – 307ExtracellularSequence analysisAdd BLAST14
Transmembranei308 – 332Helical; Name=6Sequence analysisAdd BLAST25
Topological domaini333 – 378CytoplasmicSequence analysisAdd BLAST46
Transmembranei379 – 400Helical; Name=7Sequence analysisAdd BLAST22
Topological domaini401 – 420ExtracellularSequence analysisAdd BLAST20
Transmembranei421 – 444Helical; Name=8Sequence analysisAdd BLAST24
Topological domaini445 – 448CytoplasmicSequence analysis4
Transmembranei449 – 471Helical; Name=9Sequence analysisAdd BLAST23
Topological domaini472 – 580ExtracellularSequence analysisAdd BLAST109
Transmembranei581 – 603Helical; Name=10Sequence analysisAdd BLAST23
Topological domaini604 – 612CytoplasmicSequence analysis9
Transmembranei613 – 638Helical; Name=11Sequence analysisAdd BLAST26
Topological domaini639 – 671ExtracellularSequence analysisAdd BLAST33
Transmembranei672 – 689Helical; Name=12Sequence analysisAdd BLAST18
Topological domaini690 – 722CytoplasmicSequence analysisAdd BLAST33

Keywords - Cellular componenti

Cell membrane, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
28231

Open Targets

More...
OpenTargetsi
ENSG00000101187

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA35838

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...
ChEMBLi
CHEMBL2073679

Drug and drug target database

More...
DrugBanki
DB01053 Benzylpenicillin
DB00286 Conjugated Equine Estrogens
DB00509 Dextrothyroxine
DB00390 Digoxin
DB00917 Dinoprostone
DB00783 Estradiol
DB00451 Levothyroxine
DB00279 Liothyronine
DB01583 Liotrix
DB04348 Taurocholic Acid

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
SLCO4A1

Domain mapping of disease mutations (DMDM)

More...
DMDMi
27734555

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001910671 – 722Solute carrier organic anion transporter family member 4A1Add BLAST722

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei34PhosphoserineCombined sources1
Modified residuei37PhosphothreonineCombined sources1
Modified residuei40PhosphoserineCombined sources1
Modified residuei43PhosphoserineCombined sources1
Modified residuei46PhosphoserineCombined sources1
Modified residuei50PhosphoserineCombined sources1
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi499N-linked (GlcNAc...) asparagineSequence analysis1
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi504 ↔ 530PROSITE-ProRule annotation
Disulfide bondi508 ↔ 519PROSITE-ProRule annotation
Disulfide bondi510 ↔ 534PROSITE-ProRule annotation
Glycosylationi557N-linked (GlcNAc...) asparagineSequence analysis1

Keywords - PTMi

Disulfide bond, Glycoprotein, Phosphoprotein

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q96BD0

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q96BD0

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q96BD0

PeptideAtlas

More...
PeptideAtlasi
Q96BD0

PRoteomics IDEntifications database

More...
PRIDEi
Q96BD0

ProteomicsDB human proteome resource

More...
ProteomicsDBi
76061
76062 [Q96BD0-2]
76063 [Q96BD0-3]
76064 [Q96BD0-4]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q96BD0

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q96BD0

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
Q96BD0

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Ubiquitous, with the exception of spleen and leukocytes.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000101187 Expressed in 182 organ(s), highest expression level in right lung

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q96BD0 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q96BD0 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA030669
HPA030670

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
118180, 4 interactors

Protein interaction database and analysis system

More...
IntActi
Q96BD0, 7 interactors

Molecular INTeraction database

More...
MINTi
Q96BD0

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000217159

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini498 – 555Kazal-likePROSITE-ProRule annotationAdd BLAST58

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG3626 Eukaryota
ENOG410XRSF LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00950000182739

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q96BD0

KEGG Orthology (KO)

More...
KOi
K14354

Identification of Orthologs from Complete Genome Data

More...
OMAi
KVWIGAW

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q96BD0

TreeFam database of animal gene trees

More...
TreeFami
TF317540

Family and domain databases

Conserved Domains Database

More...
CDDi
cd06174 MFS, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR002350 Kazal_dom
IPR036058 Kazal_dom_sf
IPR020846 MFS_dom
IPR036259 MFS_trans_sf
IPR004156 OATP

The PANTHER Classification System

More...
PANTHERi
PTHR11388 PTHR11388, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF07648 Kazal_2, 1 hit
PF03137 OATP, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF100895 SSF100895, 1 hit
SSF103473 SSF103473, 1 hit

TIGRFAMs; a protein family database

More...
TIGRFAMsi
TIGR00805 oat, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS51465 KAZAL_2, 1 hit
PS50850 MFS, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Note: Experimental confirmation may be lacking for some isoforms.

This entry has 4 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q96BD0-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MPLHQLGDKP LTFPSPNSAM ENGLDHTPPS RRASPGTPLS PGSLRSAAHS
60 70 80 90 100
PLDTSKQPLC QLWAEKHGAR GTHEVRYVSA GQSVACGWWA FAPPCLQVLN
110 120 130 140 150
TPKGILFFLC AAAFLQGMTV NGFINTVITS LERRYDLHSY QSGLIASSYD
160 170 180 190 200
IAACLCLTFV SYFGGSGHKP RWLGWGVLLM GTGSLVFALP HFTAGRYEVE
210 220 230 240 250
LDAGVRTCPA NPGAVCADST SGLSRYQLVF MLGQFLHGVG ATPLYTLGVT
260 270 280 290 300
YLDENVKSSC SPVYIAIFYT AAILGPAAGY LIGGALLNIY TEMGRRTELT
310 320 330 340 350
TESPLWVGAW WVGFLGSGAA AFFTAVPILG YPRQLPGSQR YAVMRAAEMH
360 370 380 390 400
QLKDSSRGEA SNPDFGKTIR DLPLSIWLLL KNPTFILLCL AGATEATLIT
410 420 430 440 450
GMSTFSPKFL ESQFSLSASE AATLFGYLVV PAGGGGTFLG GFFVNKLRLR
460 470 480 490 500
GSAVIKFCLF CTVVSLLGIL VFSLHCPSVP MAGVTASYGG SLLPEGHLNL
510 520 530 540 550
TAPCNAACSC QPEHYSPVCG SDGLMYFSLC HAGCPAATET NVDGQKVYRD
560 570 580 590 600
CSCIPQNLSS GFGHATAGKC TSTCQRKPLL LVFIFVVIFF TFLSSIPALT
610 620 630 640 650
ATLRCVRDPQ RSFALGIQWI VVRILGGIPG PIAFGWVIDK ACLLWQDQCG
660 670 680 690 700
QQGSCLVYQN SAMSRYILIM GLLYKVLGVL FFAIACFLYK PLSESSDGLE
710 720
TCLPSQSSAP DSATDSQLQS SV
Length:722
Mass (Da):77,193
Last modified:January 10, 2003 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iDD8F0C10E4BCD255
GO
Isoform 2 (identifier: Q96BD0-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     250-410: TYLDENVKSS...GMSTFSPKFL → LFFAIACFLYKPLS
     686-722: CFLYKPLSES...ATDSQLQSSV → SSRAASDHRP...ELLFDLQPST

Show »
Length:583
Mass (Da):62,325
Checksum:i67342B00D99DCB31
GO
Isoform 3 (identifier: Q96BD0-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     548-661: YRDCSCIPQN...QGSCLVYQNS → SGAAAYRPCP...QHPEAELCRS
     662-722: Missing.

Show »
Length:661
Mass (Da):70,454
Checksum:i39E50AB1FC24B071
GO
Isoform 4 (identifier: Q96BD0-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     572-603: STCQRKPLLLVFIFVVIFFTFLSSIPALTATL → TTALCAARTASCTSHCATQGALQPRRRMWTAR

Show »
Length:722
Mass (Da):77,084
Checksum:i8A5B9415E0B1CB63
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E1P5H9E1P5H9_HUMAN
Solute carrier organic anion transp...
SLCO4A1 hCG_1748044
620Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0A0MT51A0A0A0MT51_HUMAN
Solute carrier organic anion transp...
SLCO4A1
151Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAA91247 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti246T → M in BAB14566 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_05367870R → Q. Corresponds to variant dbSNP:rs34419428Ensembl.1
Natural variantiVAR_05367978V → I1 PublicationCorresponds to variant dbSNP:rs1047099Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_006152250 – 410TYLDE…SPKFL → LFFAIACFLYKPLS in isoform 2. 1 PublicationAdd BLAST161
Alternative sequenceiVSP_006153548 – 661YRDCS…VYQNS → SGAAAYRPCPPLDPGKGPPC LPLVIGAIVGLPRCTETVAV SLRIFPLVLAMHCREMHFNL SEKAPPSGFHIRCNFLYIPQ QHSCTNGNSTVSWGRVCACP ELSLQHPEAELCRS in isoform 3. CuratedAdd BLAST114
Alternative sequenceiVSP_006154572 – 603STCQR…LTATL → TTALCAARTASCTSHCATQG ALQPRRRMWTAR in isoform 4. 1 PublicationAdd BLAST32
Alternative sequenceiVSP_006155662 – 722Missing in isoform 3. CuratedAdd BLAST61
Alternative sequenceiVSP_006156686 – 722CFLYK…LQSSV → SSRAASDHRPRPPGHGGHSA FPDDRTVPLGDAITRELLFD LQPST in isoform 2. 1 PublicationAdd BLAST37

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AB031051 mRNA Translation: BAA89288.1
AF187817 mRNA Translation: AAG43447.1
AF104334 mRNA Translation: AAF15545.1
AF205072 mRNA Translation: AAG42204.1
AK023410 mRNA Translation: BAB14566.1
AK000551 mRNA Translation: BAA91247.1 Different initiation.
AL357033 Genomic DNA No translation available.
BC015727 mRNA Translation: AAH15727.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS13501.1 [Q96BD0-1]

NCBI Reference Sequences

More...
RefSeqi
NP_057438.3, NM_016354.3 [Q96BD0-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000217159; ENSP00000217159; ENSG00000101187 [Q96BD0-1]
ENST00000370507; ENSP00000359538; ENSG00000101187 [Q96BD0-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
28231

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:28231

UCSC genome browser

More...
UCSCi
uc002ydb.1 human [Q96BD0-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB031051 mRNA Translation: BAA89288.1
AF187817 mRNA Translation: AAG43447.1
AF104334 mRNA Translation: AAF15545.1
AF205072 mRNA Translation: AAG42204.1
AK023410 mRNA Translation: BAB14566.1
AK000551 mRNA Translation: BAA91247.1 Different initiation.
AL357033 Genomic DNA No translation available.
BC015727 mRNA Translation: AAH15727.1
CCDSiCCDS13501.1 [Q96BD0-1]
RefSeqiNP_057438.3, NM_016354.3 [Q96BD0-1]

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

BioGridi118180, 4 interactors
IntActiQ96BD0, 7 interactors
MINTiQ96BD0
STRINGi9606.ENSP00000217159

Chemistry databases

ChEMBLiCHEMBL2073679
DrugBankiDB01053 Benzylpenicillin
DB00286 Conjugated Equine Estrogens
DB00509 Dextrothyroxine
DB00390 Digoxin
DB00917 Dinoprostone
DB00783 Estradiol
DB00451 Levothyroxine
DB00279 Liothyronine
DB01583 Liotrix
DB04348 Taurocholic Acid

Protein family/group databases

MEROPSiI01.972
TCDBi2.A.60.1.9 the organo anion transporter (oat) family

PTM databases

iPTMnetiQ96BD0
PhosphoSitePlusiQ96BD0
SwissPalmiQ96BD0

Polymorphism and mutation databases

BioMutaiSLCO4A1
DMDMi27734555

Proteomic databases

jPOSTiQ96BD0
MaxQBiQ96BD0
PaxDbiQ96BD0
PeptideAtlasiQ96BD0
PRIDEiQ96BD0
ProteomicsDBi76061
76062 [Q96BD0-2]
76063 [Q96BD0-3]
76064 [Q96BD0-4]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
28231
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000217159; ENSP00000217159; ENSG00000101187 [Q96BD0-1]
ENST00000370507; ENSP00000359538; ENSG00000101187 [Q96BD0-1]
GeneIDi28231
KEGGihsa:28231
UCSCiuc002ydb.1 human [Q96BD0-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
28231
DisGeNETi28231

GeneCards: human genes, protein and diseases

More...
GeneCardsi
SLCO4A1

H-Invitational Database, human transcriptome db

More...
H-InvDBi
HIX0015985
HIX0138058
HGNCiHGNC:10953 SLCO4A1
HPAiHPA030669
HPA030670
MIMi612436 gene
neXtProtiNX_Q96BD0
OpenTargetsiENSG00000101187
PharmGKBiPA35838

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG3626 Eukaryota
ENOG410XRSF LUCA
GeneTreeiENSGT00950000182739
InParanoidiQ96BD0
KOiK14354
OMAiKVWIGAW
PhylomeDBiQ96BD0
TreeFamiTF317540

Enzyme and pathway databases

ReactomeiR-HSA-879518 Transport of organic anions

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
SLCO4A1 human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
SLCO4A1

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
28231

Protein Ontology

More...
PROi
PR:Q96BD0

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000101187 Expressed in 182 organ(s), highest expression level in right lung
ExpressionAtlasiQ96BD0 baseline and differential
GenevisibleiQ96BD0 HS

Family and domain databases

CDDicd06174 MFS, 1 hit
InterProiView protein in InterPro
IPR002350 Kazal_dom
IPR036058 Kazal_dom_sf
IPR020846 MFS_dom
IPR036259 MFS_trans_sf
IPR004156 OATP
PANTHERiPTHR11388 PTHR11388, 1 hit
PfamiView protein in Pfam
PF07648 Kazal_2, 1 hit
PF03137 OATP, 1 hit
SUPFAMiSSF100895 SSF100895, 1 hit
SSF103473 SSF103473, 1 hit
TIGRFAMsiTIGR00805 oat, 1 hit
PROSITEiView protein in PROSITE
PS51465 KAZAL_2, 1 hit
PS50850 MFS, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiSO4A1_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q96BD0
Secondary accession number(s): Q9H4T7
, Q9H4T8, Q9H8P2, Q9NWX8, Q9UI35, Q9UIG7
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: January 10, 2003
Last sequence update: January 10, 2003
Last modified: May 8, 2019
This is version 162 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 20
    Human chromosome 20: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again