Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

SH3 domain-containing kinase-binding protein 1

Gene

SH3KBP1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Adapter protein involved in regulating diverse signal transduction pathways. Involved in the regulation of endocytosis and lysosomal degradation of ligand-induced receptor tyrosine kinases, including EGFR and MET/hepatocyte growth factor receptor, through an association with CBL and endophilins. The association with CBL, and thus the receptor internalization, may inhibited by an interaction with PDCD6IP and/or SPRY2. Involved in regulation of ligand-dependent endocytosis of the IgE receptor. Attenuates phosphatidylinositol 3-kinase activity by interaction with its regulatory subunit (By similarity). May be involved in regulation of cell adhesion; promotes the interaction between TTK2B and PDCD6IP. May be involved in the regulation of cellular stress response via the MAPK pathways through its interaction with MAP3K4. Is involved in modulation of tumor necrosis factor mediated apoptosis. Plays a role in the regulation of cell morphology and cytoskeletal organization. Required in the control of cell shape and migration.By similarity10 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

  • apoptotic process Source: UniProtKB-KW
  • axon guidance Source: Reactome
  • cell-cell signaling Source: UniProtKB
  • cell migration Source: UniProtKB
  • cytoskeleton organization Source: UniProtKB
  • endocytosis Source: UniProtKB-KW
  • membrane organization Source: Reactome
  • negative regulation of epidermal growth factor receptor signaling pathway Source: Reactome
  • regulation of cell shape Source: UniProtKB

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processApoptosis, Endocytosis

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-182971 EGFR downregulation
R-HSA-6807004 Negative regulation of MET activity
R-HSA-8856825 Cargo recognition for clathrin-mediated endocytosis
R-HSA-8856828 Clathrin-mediated endocytosis
R-HSA-8866376 Reelin signalling pathway
R-HSA-8875360 InlB-mediated entry of Listeria monocytogenes into host cell
R-HSA-983695 Antigen activates B Cell Receptor (BCR) leading to generation of second messengers

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...
SignaLinki
Q96B97

SIGNOR Signaling Network Open Resource

More...
SIGNORi
Q96B97

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
SH3 domain-containing kinase-binding protein 1
Alternative name(s):
CD2-binding protein 3
Short name:
CD2BP3
Cbl-interacting protein of 85 kDa
Human Src family kinase-binding protein 1
Short name:
HSB-1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:SH3KBP1
Synonyms:CIN85
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome X

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000147010.17

Human Gene Nomenclature Database

More...
HGNCi
HGNC:13867 SH3KBP1

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
300374 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q96B97

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell junction, Cytoplasm, Cytoplasmic vesicle, Cytoskeleton, Membrane, Synapse, Synaptosome

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
30011

Open Targets

More...
OpenTargetsi
ENSG00000147010

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA37822

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
SH3KBP1

Domain mapping of disease mutations (DMDM)

More...
DMDMi
31077034

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000977281 – 665SH3 domain-containing kinase-binding protein 1Add BLAST665

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei156PhosphoserineBy similarity1
Modified residuei159PhosphoserineBy similarity1
Modified residuei183PhosphoserineCombined sources1
Modified residuei230PhosphoserineCombined sources1
Modified residuei254PhosphothreonineCombined sources1
Modified residuei436PhosphoserineCombined sources1
Modified residuei509PhosphoserineCombined sources1
Modified residuei511PhosphoserineCombined sources1
Modified residuei521PhosphoserineCombined sources1
Modified residuei587PhosphoserineCombined sources1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Monoubiquitinated by CBL and CBLB after EGF stimulation; probably on its C-terminus.

Keywords - PTMi

Phosphoprotein, Ubl conjugation

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q96B97

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q96B97

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q96B97

PeptideAtlas

More...
PeptideAtlasi
Q96B97

PRoteomics IDEntifications database

More...
PRIDEi
Q96B97

ProteomicsDB human proteome resource

More...
ProteomicsDBi
76057
76058 [Q96B97-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q96B97

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q96B97

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Ubiquitously expressed. Also expressed in some cancer cell lines.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000147010 Expressed in 208 organ(s), highest expression level in secondary oocyte

CleanEx database of gene expression profiles

More...
CleanExi
HS_SH3KBP1

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q96B97 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q96B97 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
CAB021892
HPA003351
HPA003355

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Can self-associate and form homotetramers. Interacts with CD2, F-actin capping protein, PIK3R3, GRB2, EGFR, MET, BLNK, MAP3K4, PDCD6IP, SPRY2, ARHGAP17, ARHGAP27, MAGI2, CRK, BCAR1, SOS1, ASAP1, ARAP3, HIP1R, SYNJ2, INPP5D and STAP1. Interacts with CBL and CBLB, but does not interact with CBLC. Two molecules of SH3KBP1 seem to bind through their respective SH3 1 domain to one molecule of CBLB. The interaction with CBL or CBLB and EGFR is increased upon EGF stimulation. The interaction with CBL is attenuated by PDCD6IP. Interacts through its proline-rich region with the SH3 domain of endophilins SH3GL1, SH3GL2 and SH3GL3. The SH3KBP1-endophilin complex seems to associate with a complex containing the phosphorylated receptor (EGFR or MET) and phosphorylated CBL. Probably associates with ASAP1 and phosphorylated EGFR. Probably part of a complex consisting of at least SH3KBP1, ASAP1 and ARAP3. Interacts with focal adhesion kinases PTK2/FAK1 AND PTK2B/PYK2, probably as a dimer. Interacts with DAB2 and probably associates with chathrin through its interaction with DAB2. Part of a complex consisting of SH3KBP1, DAB2, and clathrin heavy chain. DAB2 and clathrin dissociate from SH3KBP1 following growth factor treatment, enabling interaction with CBL. Interacts with DDN and probably associates with MAGI2 through its interaction with DDN. Interacts with the SH3 domains of SRC tyrosine-protein kinases SRC, LCK, LYN, FGR, FYN and HCK. Interacts with TRADD, BIRC2, TRAF1, TRAF2 and TNFR1, and the association with a TNFR1-associated complex upon stimulation with TNF-alpha seems to be mediated by SRC. Interacts (via SH3 domains) with SHKBP1 (via PXXXPR motifs) (By similarity). Interaction with CBL is abolished in the presence of SHKBP1 (By similarity). Interacts (via SH3 domains) with ZFP36 (via extreme C-terminal region) (PubMed:20221403). Interacts with MAP3K4; this interaction enhances the association with ZFP36 (PubMed:20221403).By similarity18 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
119029, 274 interactors

CORUM comprehensive resource of mammalian protein complexes

More...
CORUMi
Q96B97

Database of interacting proteins

More...
DIPi
DIP-31803N

Protein interaction database and analysis system

More...
IntActi
Q96B97, 60 interactors

Molecular INTeraction database

More...
MINTi
Q96B97

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000380921

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1665
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q96B97

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q96B97

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
Q96B97

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini1 – 58SH3 1PROSITE-ProRule annotationAdd BLAST58
Domaini98 – 157SH3 2PROSITE-ProRule annotationAdd BLAST60
Domaini267 – 328SH3 3PROSITE-ProRule annotationAdd BLAST62

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and domains’ section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili602 – 664Sequence analysisAdd BLAST63

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi327 – 428Pro-richAdd BLAST102

Keywords - Domaini

Coiled coil, Repeat, SH3 domain, SH3-binding

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG4348 Eukaryota
ENOG410XQBY LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000155886

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000231405

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG057824

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q96B97

KEGG Orthology (KO)

More...
KOi
K12470

Identification of Orthologs from Complete Genome Data

More...
OMAi
EDKEEHV

Database of Orthologous Groups

More...
OrthoDBi
EOG091G041Q

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q96B97

TreeFam database of animal gene trees

More...
TreeFami
TF350191

Family and domain databases

Conserved Domains Database

More...
CDDi
cd12052 SH3_CIN85_1, 1 hit
cd12055 SH3_CIN85_2, 1 hit
cd12057 SH3_CIN85_3, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR035770 CIN85_SH3_1
IPR035771 CIN85_SH3_2
IPR035772 CIN85_SH3_3
IPR036028 SH3-like_dom_sf
IPR001452 SH3_domain

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF14604 SH3_9, 3 hits

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00452 SH3DOMAIN

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00326 SH3, 3 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF50044 SSF50044, 3 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50002 SH3, 3 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q96B97-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MVEAIVEFDY QAQHDDELTI SVGEIITNIR KEDGGWWEGQ INGRRGLFPD
60 70 80 90 100
NFVREIKKEM KKDPLTNKAP EKPLHEVPSG NSLLSSETIL RTNKRGERRR
110 120 130 140 150
RRCQVAFSYL PQNDDELELK VGDIIEVVGE VEEGWWEGVL NGKTGMFPSN
160 170 180 190 200
FIKELSGESD ELGISQDEQL SKSSLRETTG SESDGGDSSS TKSEGANGTV
210 220 230 240 250
ATAAIQPKKV KGVGFGDIFK DKPIKLRPRS IEVENDFLPV EKTIGKKLPA
260 270 280 290 300
TTATPDSSKT EMDSRTKSKD YCKVIFPYEA QNDDELTIKE GDIVTLINKD
310 320 330 340 350
CIDVGWWEGE LNGRRGVFPD NFVKLLPPDF EKEGNRPKKP PPPSAPVIKQ
360 370 380 390 400
GAGTTERKHE IKKIPPERPE MLPNRTEEKE RPEREPKLDL QKPSVPAIPP
410 420 430 440 450
KKPRPPKTNS LSRPGALPPR RPERPVGPLT HTRGDSPKID LAGSSLSGIL
460 470 480 490 500
DKDLSDRSND IDLEGFDSVV SSTEKLSHPT TSRPKATGRR PPSQSLTSSS
510 520 530 540 550
LSSPDIFDSP SPEEDKEEHI SLAHRGVDAS KKTSKTVTIS QVSDNKASLP
560 570 580 590 600
PKPGTMAAGG GGPAPLSSAA PSPLSSSLGT AGHRANSPSL FGTEGKPKME
610 620 630 640 650
PAASSQAAVE ELRTQVRELR SIIETMKDQQ KREIKQLLSE LDEEKKIRLR
660
LQMEVNDIKK ALQSK
Note: Interacts with CBL.
Length:665
Mass (Da):73,126
Last modified:May 23, 2003 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i3BD350FCDB14BD4C
GO
Isoform 2 (identifier: Q96B97-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-54: MVEAIVEFDYQAQHDDELTISVGEIITNIRKEDGGWWEGQINGRRGLFPDNFVR → MEVSAAKAPSAADLSEI

Note: Interacts with CD2 cytoplasmic tail and does not interact with F-actin.
Show »
Length:628
Mass (Da):68,550
Checksum:i8AD93481480879D6
GO
Isoform 3 (identifier: Q96B97-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-4: MVEA → MGEE
     5-242: Missing.

Note: No experimental confirmation available.
Show »
Length:427
Mass (Da):46,610
Checksum:iCDD6AC2770E695F4
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
Q5JPT2Q5JPT2_HUMAN
SH3 domain-containing kinase-bindin...
SH3KBP1
645Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
Q5JPT3Q5JPT3_HUMAN
SH3 domain-containing kinase-bindin...
SH3KBP1
149Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
Q5JPT1Q5JPT1_HUMAN
SH3 domain-containing kinase-bindin...
SH3KBP1
208Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
Q5VSN0Q5VSN0_HUMAN
SH3 domain-containing kinase-bindin...
SH3KBP1
553Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAH50663 differs from that shown. Contaminating sequence. Potential poly-A sequence.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti288I → T in BAH11471 (PubMed:14702039).Curated1
Sequence conflicti426V → A in BAH11471 (PubMed:14702039).Curated1
Sequence conflicti570A → V in AAH15806 (PubMed:15489334).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_015667382P → L1 PublicationCorresponds to variant dbSNP:rs1310665369Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0075041 – 54MVEAI…DNFVR → MEVSAAKAPSAADLSEI in isoform 2. 2 PublicationsAdd BLAST54
Alternative sequenceiVSP_0446551 – 4MVEA → MGEE in isoform 3. 1 Publication4
Alternative sequenceiVSP_0446565 – 242Missing in isoform 3. 1 PublicationAdd BLAST238

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF230904 mRNA Translation: AAF37854.1
AF542051 mRNA Translation: AAN77231.1
AK293234 mRNA Translation: BAH11470.1
AK293237 mRNA Translation: BAH11471.1
AL732423 Genomic DNA No translation available.
AL732327 Genomic DNA No translation available.
AL732325 Genomic DNA No translation available.
AL732409 Genomic DNA No translation available.
AL772197 Genomic DNA No translation available.
BC015806 mRNA Translation: AAH15806.1
BC050663 mRNA Translation: AAH50663.1 Sequence problems.
AF329267 mRNA Translation: AAK95587.1
AF329268 mRNA Translation: AAO13348.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS14193.1 [Q96B97-1]
CCDS35213.1 [Q96B97-2]
CCDS55383.1 [Q96B97-3]

Protein sequence database of the Protein Information Resource

More...
PIRi
JC7191

NCBI Reference Sequences

More...
RefSeqi
NP_001019837.1, NM_001024666.2 [Q96B97-2]
NP_001171889.1, NM_001184960.1 [Q96B97-3]
NP_114098.1, NM_031892.2 [Q96B97-1]
XP_016884958.1, XM_017029469.1

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.726365

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000379698; ENSP00000369020; ENSG00000147010 [Q96B97-2]
ENST00000379716; ENSP00000369039; ENSG00000147010 [Q96B97-3]
ENST00000397821; ENSP00000380921; ENSG00000147010 [Q96B97-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
30011

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:30011

UCSC genome browser

More...
UCSCi
uc004czl.4 human [Q96B97-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF230904 mRNA Translation: AAF37854.1
AF542051 mRNA Translation: AAN77231.1
AK293234 mRNA Translation: BAH11470.1
AK293237 mRNA Translation: BAH11471.1
AL732423 Genomic DNA No translation available.
AL732327 Genomic DNA No translation available.
AL732325 Genomic DNA No translation available.
AL732409 Genomic DNA No translation available.
AL772197 Genomic DNA No translation available.
BC015806 mRNA Translation: AAH15806.1
BC050663 mRNA Translation: AAH50663.1 Sequence problems.
AF329267 mRNA Translation: AAK95587.1
AF329268 mRNA Translation: AAO13348.1
CCDSiCCDS14193.1 [Q96B97-1]
CCDS35213.1 [Q96B97-2]
CCDS55383.1 [Q96B97-3]
PIRiJC7191
RefSeqiNP_001019837.1, NM_001024666.2 [Q96B97-2]
NP_001171889.1, NM_001184960.1 [Q96B97-3]
NP_114098.1, NM_031892.2 [Q96B97-1]
XP_016884958.1, XM_017029469.1
UniGeneiHs.726365

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2BZ8X-ray2.00A/B1-58[»]
2K6DNMR-A267-328[»]
2K9GNMR-A262-333[»]
2N64NMR-A/B/C594-665[»]
2O2ONMR-A92-168[»]
2YDLX-ray2.05A270-328[»]
5ABSX-ray1.74A599-662[»]
ProteinModelPortaliQ96B97
SMRiQ96B97
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi119029, 274 interactors
CORUMiQ96B97
DIPiDIP-31803N
IntActiQ96B97, 60 interactors
MINTiQ96B97
STRINGi9606.ENSP00000380921

PTM databases

iPTMnetiQ96B97
PhosphoSitePlusiQ96B97

Polymorphism and mutation databases

BioMutaiSH3KBP1
DMDMi31077034

Proteomic databases

EPDiQ96B97
MaxQBiQ96B97
PaxDbiQ96B97
PeptideAtlasiQ96B97
PRIDEiQ96B97
ProteomicsDBi76057
76058 [Q96B97-2]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
30011
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000379698; ENSP00000369020; ENSG00000147010 [Q96B97-2]
ENST00000379716; ENSP00000369039; ENSG00000147010 [Q96B97-3]
ENST00000397821; ENSP00000380921; ENSG00000147010 [Q96B97-1]
GeneIDi30011
KEGGihsa:30011
UCSCiuc004czl.4 human [Q96B97-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
30011
DisGeNETi30011
EuPathDBiHostDB:ENSG00000147010.17

GeneCards: human genes, protein and diseases

More...
GeneCardsi
SH3KBP1
HGNCiHGNC:13867 SH3KBP1
HPAiCAB021892
HPA003351
HPA003355
MIMi300374 gene
neXtProtiNX_Q96B97
OpenTargetsiENSG00000147010
PharmGKBiPA37822

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG4348 Eukaryota
ENOG410XQBY LUCA
GeneTreeiENSGT00940000155886
HOGENOMiHOG000231405
HOVERGENiHBG057824
InParanoidiQ96B97
KOiK12470
OMAiEDKEEHV
OrthoDBiEOG091G041Q
PhylomeDBiQ96B97
TreeFamiTF350191

Enzyme and pathway databases

ReactomeiR-HSA-182971 EGFR downregulation
R-HSA-6807004 Negative regulation of MET activity
R-HSA-8856825 Cargo recognition for clathrin-mediated endocytosis
R-HSA-8856828 Clathrin-mediated endocytosis
R-HSA-8866376 Reelin signalling pathway
R-HSA-8875360 InlB-mediated entry of Listeria monocytogenes into host cell
R-HSA-983695 Antigen activates B Cell Receptor (BCR) leading to generation of second messengers
SignaLinkiQ96B97
SIGNORiQ96B97

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
SH3KBP1 human
EvolutionaryTraceiQ96B97

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
SH3KBP1

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
30011

Protein Ontology

More...
PROi
PR:Q96B97

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000147010 Expressed in 208 organ(s), highest expression level in secondary oocyte
CleanExiHS_SH3KBP1
ExpressionAtlasiQ96B97 baseline and differential
GenevisibleiQ96B97 HS

Family and domain databases

CDDicd12052 SH3_CIN85_1, 1 hit
cd12055 SH3_CIN85_2, 1 hit
cd12057 SH3_CIN85_3, 1 hit
InterProiView protein in InterPro
IPR035770 CIN85_SH3_1
IPR035771 CIN85_SH3_2
IPR035772 CIN85_SH3_3
IPR036028 SH3-like_dom_sf
IPR001452 SH3_domain
PfamiView protein in Pfam
PF14604 SH3_9, 3 hits
PRINTSiPR00452 SH3DOMAIN
SMARTiView protein in SMART
SM00326 SH3, 3 hits
SUPFAMiSSF50044 SSF50044, 3 hits
PROSITEiView protein in PROSITE
PS50002 SH3, 3 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiSH3K1_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q96B97
Secondary accession number(s): B7Z1D5
, Q5JPT4, Q5JPT5, Q8IWX6, Q8IX98, Q96RN4, Q9NYR0
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 23, 2003
Last sequence update: May 23, 2003
Last modified: December 5, 2018
This is version 172 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome X
    Human chromosome X: entries, gene names and cross-references to MIM
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again