Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - Q96AX2 (RAB37_HUMAN)

Entry version 167 (16 Oct 2019)
Sequence version 3 (23 Jan 2007)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Ras-related protein Rab-37

Gene

RAB37

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes a region in the protein which binds nucleotide phosphates. It always involves more than one amino acid and includes all residues involved in nucleotide-binding.<p><a href='/help/np_bind' target='_top'>More...</a></p>Nucleotide bindingi36 – 43GTPBy similarity8
Nucleotide bindingi85 – 89GTPBy similarity5
Nucleotide bindingi143 – 146GTPBy similarity4

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processProtein transport, Transport
LigandGTP-binding, Nucleotide-binding

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-6798695 Neutrophil degranulation
R-HSA-8873719 RAB geranylgeranylation

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Ras-related protein Rab-37
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:RAB37
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 17

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:30268 RAB37

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		609956 gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_Q96AX2

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasmic vesicle

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...DisGeNETi		326624

Open Targets

More...OpenTargetsi		ENSG00000172794

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA134901093

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		Q96AX2

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		RAB37

Domain mapping of disease mutations (DMDM)

More...DMDMi		20139581

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section indicates that the initiator methionine is cleaved from the mature protein.<p><a href='/help/init_met' target='_top'>More...</a></p>Initiator methionineiRemoved1 Publication
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001212492 – 220Ras-related protein Rab-37Add BLAST219
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section describes a propeptide, which is a part of a protein that is cleaved during maturation or activation. Once cleaved, a propeptide generally has no independent biological function.<p><a href='/help/propep' target='_top'>More...</a></p>PropeptideiPRO_0000370828221 – 223Removed in mature formSequence analysis3

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei2N-acetylthreonine1 Publication1
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position(s) and the type of covalently attached lipid group(s).<p><a href='/help/lipid' target='_top'>More...</a></p>Lipidationi219S-geranylgeranyl cysteineBy similarity1
Modified residuei220Cysteine methyl esterSequence analysis1
Lipidationi220S-geranylgeranyl cysteineBy similarity1

Keywords - PTMi

Acetylation, Lipoprotein, Methylation, Prenylation

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		Q96AX2

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		Q96AX2

MaxQB - The MaxQuant DataBase

More...MaxQBi		Q96AX2

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q96AX2

PeptideAtlas

More...PeptideAtlasi		Q96AX2

PRoteomics IDEntifications database

More...PRIDEi		Q96AX2

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		76005 [Q96AX2-1]
76006 [Q96AX2-2]
76007 [Q96AX2-3]
76008 [Q96AX2-4]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q96AX2

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q96AX2

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000172794 Expressed in 135 organ(s), highest expression level in right hemisphere of cerebellum

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		Q96AX2 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q96AX2 HS

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with RIMS1.

By similarity

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

WithEntry#Exp.IntActNotes
Q969L23EBI-748121,EBI-944295

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...BioGridi		130604, 6 interactors

Protein interaction database and analysis system

More...IntActi		Q96AX2, 5 interactors

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000376390

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		Q96AX2

Database of comparative protein structure models

More...ModBasei		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi59 – 67Effector regionBy similarity9

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the small GTPase superfamily. Rab family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG0083 Eukaryota
ENOG410Z9H6 LUCA

Ensembl GeneTree

More...GeneTreei		ENSGT00940000158883

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		HOG000233968

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q96AX2

KEGG Orthology (KO)

More...KOi		K07914

Identification of Orthologs from Complete Genome Data

More...OMAi		AGPDFHE

Database of Orthologous Groups

More...OrthoDBi		1018397at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q96AX2

TreeFam database of animal gene trees

More...TreeFami		TF323428

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR027417 P-loop_NTPase
IPR005225 Small_GTP-bd_dom
IPR001806 Small_GTPase

Pfam protein domain database

More...Pfami		View protein in Pfam
PF00071 Ras, 1 hit

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF52540 SSF52540, 1 hit

TIGRFAMs; a protein family database

More...TIGRFAMsi		TIGR00231 small_GTP, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS51419 RAB, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q96AX2-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MTGTPGAVAT RDGEAPERSP PCSPSYDLTG KVMLLGDTGV GKTCFLIQFK 
        60         70         80         90        100
DGAFLSGTFI ATVGIDFRNK VVTVDGVRVK LQIWDTAGQE RFRSVTHAYY 
       110        120        130        140        150
RDAQALLLLY DITNKSSFDN IRAWLTEIHE YAQRDVVIML LGNKADMSSE 
       160        170        180        190        200
RVIRSEDGET LAREYGVPFL ETSAKTGMNV ELAFLAIAKE LKYRAGHQAD 
       210        220 
EPSFQIRDYV ESQKKRSSCC SFM
Length:223
Mass (Da):24,815
Last modified:January 23, 2007 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i5A7A4887BCBB84A8
GO
Isoform 2 (identifier: Q96AX2-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-68: MTGTPGAVAT...FIATVGIDFR → MDLQRPDSYQ...FSATVGIGFT

Show »
Length:216
Mass (Da):24,169
Checksum:i5EBF94A735395D58
GO
Isoform 3 (identifier: Q96AX2-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-30: MTGTPGAVATRDGEAPERSPPCSPSYDLTG → MWLMSEAHGAEPVLLREAARPFTQTLRLCVPSGNS

Note: No experimental confirmation available.
Show »
Length:228
Mass (Da):25,663
Checksum:i151A1E30411A53B6
GO
Isoform 4 (identifier: Q96AX2-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     32-68: Missing.

Note: No experimental confirmation available.
Show »
Length:186
Mass (Da):20,894
Checksum:i728BB40C23162B5F
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A8MTC6A8MTC6_HUMAN
RAB37, member RAS oncogene family, ...
RAB37 hCG_1986458
189Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
B7Z3L0B7Z3L0_HUMAN
Ras-related protein Rab-37
RAB37
196Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A8MSP2A8MSP2_HUMAN
RAB37, member RAS oncogene family, ...
RAB37 hCG_1986458
182Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A8MZI4A8MZI4_HUMAN
Ras-related protein Rab-37
RAB37
191Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_034434188A → P. Corresponds to variant dbSNP:rs34215331Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0412681 – 68MTGTP…GIDFR → MDLQRPDSYQGGAGPDFNDH VLHKTILVGDSGVGKTSLLV QFDQGKFIPGSFSATVGIGF T in isoform 2. 2 PublicationsAdd BLAST68
Alternative sequenceiVSP_0431551 – 30MTGTP…YDLTG → MWLMSEAHGAEPVLLREAAR PFTQTLRLCVPSGNS in isoform 3. 1 PublicationAdd BLAST30
Alternative sequenceiVSP_04315632 – 68Missing in isoform 4. 1 PublicationAdd BLAST37

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AK098068 mRNA Translation: BAC05227.1
AK290202 mRNA Translation: BAF82891.1
AK296172 mRNA Translation: BAH12272.1
AK303442 mRNA Translation: BAH13962.1
AC016888 Genomic DNA No translation available.
AC064805 Genomic DNA No translation available.
CH471099 Genomic DNA Translation: EAW89180.1
BC016615 mRNA Translation: AAH16615.1
BC040547 mRNA Translation: AAH40547.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS11703.1 [Q96AX2-2]
CCDS32722.1 [Q96AX2-1]
CCDS54161.1 [Q96AX2-3]
CCDS54162.1 [Q96AX2-4]

NCBI Reference Sequences

More...RefSeqi		NP_001006639.1, NM_001006638.2 [Q96AX2-1]
NP_001157461.1, NM_001163989.1 [Q96AX2-3]
NP_001157462.1, NM_001163990.1 [Q96AX2-4]
NP_001317400.1, NM_001330471.1
NP_783865.1, NM_175738.4 [Q96AX2-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000392612; ENSP00000376388; ENSG00000172794 [Q96AX2-4]
ENST00000392613; ENSP00000376389; ENSG00000172794 [Q96AX2-1]
ENST00000392614; ENSP00000376390; ENSG00000172794 [Q96AX2-3]
ENST00000402449; ENSP00000383934; ENSG00000172794 [Q96AX2-2]
ENST00000481224; ENSP00000436563; ENSG00000172794 [Q96AX2-1]
ENST00000613645; ENSP00000483155; ENSG00000172794 [Q96AX2-1]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		326624

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:326624

UCSC genome browser

More...UCSCi		uc002jlk.4 human [Q96AX2-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK098068 mRNA Translation: BAC05227.1
AK290202 mRNA Translation: BAF82891.1
AK296172 mRNA Translation: BAH12272.1
AK303442 mRNA Translation: BAH13962.1
AC016888 Genomic DNA No translation available.
AC064805 Genomic DNA No translation available.
CH471099 Genomic DNA Translation: EAW89180.1
BC016615 mRNA Translation: AAH16615.1
BC040547 mRNA Translation: AAH40547.1
CCDSiCCDS11703.1 [Q96AX2-2]
CCDS32722.1 [Q96AX2-1]
CCDS54161.1 [Q96AX2-3]
CCDS54162.1 [Q96AX2-4]
RefSeqiNP_001006639.1, NM_001006638.2 [Q96AX2-1]
NP_001157461.1, NM_001163989.1 [Q96AX2-3]
NP_001157462.1, NM_001163990.1 [Q96AX2-4]
NP_001317400.1, NM_001330471.1
NP_783865.1, NM_175738.4 [Q96AX2-2]

3D structure databases

SMRiQ96AX2
ModBaseiSearch...

Protein-protein interaction databases

BioGridi130604, 6 interactors
IntActiQ96AX2, 5 interactors
STRINGi9606.ENSP00000376390

PTM databases

iPTMnetiQ96AX2
PhosphoSitePlusiQ96AX2

Polymorphism and mutation databases

BioMutaiRAB37
DMDMi20139581

Proteomic databases

jPOSTiQ96AX2
MassIVEiQ96AX2
MaxQBiQ96AX2
PaxDbiQ96AX2
PeptideAtlasiQ96AX2
PRIDEiQ96AX2
ProteomicsDBi76005 [Q96AX2-1]
76006 [Q96AX2-2]
76007 [Q96AX2-3]
76008 [Q96AX2-4]

Genome annotation databases

EnsembliENST00000392612; ENSP00000376388; ENSG00000172794 [Q96AX2-4]
ENST00000392613; ENSP00000376389; ENSG00000172794 [Q96AX2-1]
ENST00000392614; ENSP00000376390; ENSG00000172794 [Q96AX2-3]
ENST00000402449; ENSP00000383934; ENSG00000172794 [Q96AX2-2]
ENST00000481224; ENSP00000436563; ENSG00000172794 [Q96AX2-1]
ENST00000613645; ENSP00000483155; ENSG00000172794 [Q96AX2-1]
GeneIDi326624
KEGGihsa:326624
UCSCiuc002jlk.4 human [Q96AX2-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		326624
DisGeNETi326624

GeneCards: human genes, protein and diseases

More...GeneCardsi		RAB37
HGNCiHGNC:30268 RAB37
MIMi609956 gene
neXtProtiNX_Q96AX2
OpenTargetsiENSG00000172794
PharmGKBiPA134901093

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG0083 Eukaryota
ENOG410Z9H6 LUCA
GeneTreeiENSGT00940000158883
HOGENOMiHOG000233968
InParanoidiQ96AX2
KOiK07914
OMAiAGPDFHE
OrthoDBi1018397at2759
PhylomeDBiQ96AX2
TreeFamiTF323428

Enzyme and pathway databases

ReactomeiR-HSA-6798695 Neutrophil degranulation
R-HSA-8873719 RAB geranylgeranylation

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		RAB37 human

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		RAB37

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		326624
PharosiQ96AX2

Protein Ontology

More...PROi		PR:Q96AX2

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000172794 Expressed in 135 organ(s), highest expression level in right hemisphere of cerebellum
ExpressionAtlasiQ96AX2 baseline and differential
GenevisibleiQ96AX2 HS

Family and domain databases

InterProiView protein in InterPro
IPR027417 P-loop_NTPase
IPR005225 Small_GTP-bd_dom
IPR001806 Small_GTPase
PfamiView protein in Pfam
PF00071 Ras, 1 hit
SUPFAMiSSF52540 SSF52540, 1 hit
TIGRFAMsiTIGR00231 small_GTP, 1 hit
PROSITEiView protein in PROSITE
PS51419 RAB, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiRAB37_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q96AX2
Secondary accession number(s): A8MXF5, A8MYT0, Q8IWA7
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: January 31, 2002
Last sequence update: January 23, 2007
Last modified: October 16, 2019
This is version 167 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 17
    Human chromosome 17: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. SIMILARITY comments
    Index of protein domains and families
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again