Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Ras-related protein Rab-37

Gene

RAB37

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Nucleotide bindingi36 – 43GTPBy similarity8
Nucleotide bindingi85 – 89GTPBy similarity5
Nucleotide bindingi143 – 146GTPBy similarity4

GO - Molecular functioni

  • GTPase activity Source: GO_Central
  • GTP binding Source: UniProtKB-KW

GO - Biological processi

Keywordsi

Biological processProtein transport, Transport
LigandGTP-binding, Nucleotide-binding

Enzyme and pathway databases

ReactomeiR-HSA-6798695 Neutrophil degranulation
R-HSA-8873719 RAB geranylgeranylation

Names & Taxonomyi

Protein namesi
Recommended name:
Ras-related protein Rab-37
Gene namesi
Name:RAB37
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 17

Organism-specific databases

EuPathDBiHostDB:ENSG00000172794.19
HGNCiHGNC:30268 RAB37
MIMi609956 gene
neXtProtiNX_Q96AX2

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasmic vesicle

Pathology & Biotechi

Organism-specific databases

DisGeNETi326624
OpenTargetsiENSG00000172794
PharmGKBiPA134901093

Polymorphism and mutation databases

BioMutaiRAB37
DMDMi20139581

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Initiator methionineiRemoved1 Publication
ChainiPRO_00001212492 – 220Ras-related protein Rab-37Add BLAST219
PropeptideiPRO_0000370828221 – 223Removed in mature formSequence analysis3

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei2N-acetylthreonine1 Publication1
Lipidationi219S-geranylgeranyl cysteineBy similarity1
Modified residuei220Cysteine methyl esterSequence analysis1
Lipidationi220S-geranylgeranyl cysteineBy similarity1

Keywords - PTMi

Acetylation, Lipoprotein, Methylation, Prenylation

Proteomic databases

EPDiQ96AX2
MaxQBiQ96AX2
PaxDbiQ96AX2
PeptideAtlasiQ96AX2
PRIDEiQ96AX2
ProteomicsDBi76005
76006 [Q96AX2-2]
76007 [Q96AX2-3]
76008 [Q96AX2-4]

PTM databases

iPTMnetiQ96AX2
PhosphoSitePlusiQ96AX2

Expressioni

Gene expression databases

BgeeiENSG00000172794 Expressed in 135 organ(s), highest expression level in right hemisphere of cerebellum
CleanExiHS_RAB37
ExpressionAtlasiQ96AX2 baseline and differential
GenevisibleiQ96AX2 HS

Interactioni

Subunit structurei

Interacts with RIMS1.By similarity

Binary interactionsi

WithEntry#Exp.IntActNotes
MAL2Q969L23EBI-748121,EBI-944295

Protein-protein interaction databases

BioGridi130604, 5 interactors
IntActiQ96AX2, 5 interactors
STRINGi9606.ENSP00000376390

Structurei

3D structure databases

ProteinModelPortaliQ96AX2
SMRiQ96AX2
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Motifi59 – 67Effector regionBy similarity9

Sequence similaritiesi

Belongs to the small GTPase superfamily. Rab family.Curated

Phylogenomic databases

eggNOGiKOG0083 Eukaryota
ENOG410Z9H6 LUCA
GeneTreeiENSGT00900000140786
HOGENOMiHOG000233968
HOVERGENiHBG009351
InParanoidiQ96AX2
KOiK07914
OMAiHYLSSAK
OrthoDBiEOG091G0JXU
PhylomeDBiQ96AX2
TreeFamiTF323428

Family and domain databases

InterProiView protein in InterPro
IPR027417 P-loop_NTPase
IPR005225 Small_GTP-bd_dom
IPR001806 Small_GTPase
PfamiView protein in Pfam
PF00071 Ras, 1 hit
SUPFAMiSSF52540 SSF52540, 1 hit
TIGRFAMsiTIGR00231 small_GTP, 1 hit
PROSITEiView protein in PROSITE
PS51419 RAB, 1 hit

Sequences (4+)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q96AX2-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MTGTPGAVAT RDGEAPERSP PCSPSYDLTG KVMLLGDTGV GKTCFLIQFK
60 70 80 90 100
DGAFLSGTFI ATVGIDFRNK VVTVDGVRVK LQIWDTAGQE RFRSVTHAYY
110 120 130 140 150
RDAQALLLLY DITNKSSFDN IRAWLTEIHE YAQRDVVIML LGNKADMSSE
160 170 180 190 200
RVIRSEDGET LAREYGVPFL ETSAKTGMNV ELAFLAIAKE LKYRAGHQAD
210 220
EPSFQIRDYV ESQKKRSSCC SFM
Length:223
Mass (Da):24,815
Last modified:January 23, 2007 - v3
Checksum:i5A7A4887BCBB84A8
GO
Isoform 2 (identifier: Q96AX2-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-68: MTGTPGAVAT...FIATVGIDFR → MDLQRPDSYQ...FSATVGIGFT

Show »
Length:216
Mass (Da):24,169
Checksum:i5EBF94A735395D58
GO
Isoform 3 (identifier: Q96AX2-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-30: MTGTPGAVATRDGEAPERSPPCSPSYDLTG → MWLMSEAHGAEPVLLREAARPFTQTLRLCVPSGNS

Note: No experimental confirmation available.
Show »
Length:228
Mass (Da):25,663
Checksum:i151A1E30411A53B6
GO
Isoform 4 (identifier: Q96AX2-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     32-68: Missing.

Note: No experimental confirmation available.
Show »
Length:186
Mass (Da):20,894
Checksum:i728BB40C23162B5F
GO

Computationally mapped potential isoform sequencesi

There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
B7Z3L0B7Z3L0_HUMAN
cDNA FLJ61124, highly similar to Ra...
RAB37
196Annotation score:
A8MTC6A8MTC6_HUMAN
RAB37, member RAS oncogene family, ...
RAB37 hCG_1986458
189Annotation score:
A8MSP2A8MSP2_HUMAN
RAB37, member RAS oncogene family, ...
RAB37 hCG_1986458
182Annotation score:
A8MZI4A8MZI4_HUMAN
Ras-related protein Rab-37
RAB37
191Annotation score:

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_034434188A → P. Corresponds to variant dbSNP:rs34215331Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0412681 – 68MTGTP…GIDFR → MDLQRPDSYQGGAGPDFNDH VLHKTILVGDSGVGKTSLLV QFDQGKFIPGSFSATVGIGF T in isoform 2. 2 PublicationsAdd BLAST68
Alternative sequenceiVSP_0431551 – 30MTGTP…YDLTG → MWLMSEAHGAEPVLLREAAR PFTQTLRLCVPSGNS in isoform 3. 1 PublicationAdd BLAST30
Alternative sequenceiVSP_04315632 – 68Missing in isoform 4. 1 PublicationAdd BLAST37

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK098068 mRNA Translation: BAC05227.1
AK290202 mRNA Translation: BAF82891.1
AK296172 mRNA Translation: BAH12272.1
AK303442 mRNA Translation: BAH13962.1
AC016888 Genomic DNA No translation available.
AC064805 Genomic DNA No translation available.
CH471099 Genomic DNA Translation: EAW89180.1
BC016615 mRNA Translation: AAH16615.1
BC040547 mRNA Translation: AAH40547.1
CCDSiCCDS11703.1 [Q96AX2-2]
CCDS32722.1 [Q96AX2-1]
CCDS54161.1 [Q96AX2-3]
CCDS54162.1 [Q96AX2-4]
RefSeqiNP_001006639.1, NM_001006638.2 [Q96AX2-1]
NP_001157461.1, NM_001163989.1 [Q96AX2-3]
NP_001157462.1, NM_001163990.1 [Q96AX2-4]
NP_001317400.1, NM_001330471.1
NP_783865.1, NM_175738.4 [Q96AX2-2]
UniGeneiHs.351413

Genome annotation databases

EnsembliENST00000392612; ENSP00000376388; ENSG00000172794 [Q96AX2-4]
ENST00000392613; ENSP00000376389; ENSG00000172794 [Q96AX2-1]
ENST00000392614; ENSP00000376390; ENSG00000172794 [Q96AX2-3]
ENST00000402449; ENSP00000383934; ENSG00000172794 [Q96AX2-2]
ENST00000481224; ENSP00000436563; ENSG00000172794 [Q96AX2-1]
ENST00000613645; ENSP00000483155; ENSG00000172794 [Q96AX2-1]
GeneIDi326624
KEGGihsa:326624
UCSCiuc002jlk.4 human [Q96AX2-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK098068 mRNA Translation: BAC05227.1
AK290202 mRNA Translation: BAF82891.1
AK296172 mRNA Translation: BAH12272.1
AK303442 mRNA Translation: BAH13962.1
AC016888 Genomic DNA No translation available.
AC064805 Genomic DNA No translation available.
CH471099 Genomic DNA Translation: EAW89180.1
BC016615 mRNA Translation: AAH16615.1
BC040547 mRNA Translation: AAH40547.1
CCDSiCCDS11703.1 [Q96AX2-2]
CCDS32722.1 [Q96AX2-1]
CCDS54161.1 [Q96AX2-3]
CCDS54162.1 [Q96AX2-4]
RefSeqiNP_001006639.1, NM_001006638.2 [Q96AX2-1]
NP_001157461.1, NM_001163989.1 [Q96AX2-3]
NP_001157462.1, NM_001163990.1 [Q96AX2-4]
NP_001317400.1, NM_001330471.1
NP_783865.1, NM_175738.4 [Q96AX2-2]
UniGeneiHs.351413

3D structure databases

ProteinModelPortaliQ96AX2
SMRiQ96AX2
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi130604, 5 interactors
IntActiQ96AX2, 5 interactors
STRINGi9606.ENSP00000376390

PTM databases

iPTMnetiQ96AX2
PhosphoSitePlusiQ96AX2

Polymorphism and mutation databases

BioMutaiRAB37
DMDMi20139581

Proteomic databases

EPDiQ96AX2
MaxQBiQ96AX2
PaxDbiQ96AX2
PeptideAtlasiQ96AX2
PRIDEiQ96AX2
ProteomicsDBi76005
76006 [Q96AX2-2]
76007 [Q96AX2-3]
76008 [Q96AX2-4]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000392612; ENSP00000376388; ENSG00000172794 [Q96AX2-4]
ENST00000392613; ENSP00000376389; ENSG00000172794 [Q96AX2-1]
ENST00000392614; ENSP00000376390; ENSG00000172794 [Q96AX2-3]
ENST00000402449; ENSP00000383934; ENSG00000172794 [Q96AX2-2]
ENST00000481224; ENSP00000436563; ENSG00000172794 [Q96AX2-1]
ENST00000613645; ENSP00000483155; ENSG00000172794 [Q96AX2-1]
GeneIDi326624
KEGGihsa:326624
UCSCiuc002jlk.4 human [Q96AX2-1]

Organism-specific databases

CTDi326624
DisGeNETi326624
EuPathDBiHostDB:ENSG00000172794.19
GeneCardsiRAB37
HGNCiHGNC:30268 RAB37
MIMi609956 gene
neXtProtiNX_Q96AX2
OpenTargetsiENSG00000172794
PharmGKBiPA134901093
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG0083 Eukaryota
ENOG410Z9H6 LUCA
GeneTreeiENSGT00900000140786
HOGENOMiHOG000233968
HOVERGENiHBG009351
InParanoidiQ96AX2
KOiK07914
OMAiHYLSSAK
OrthoDBiEOG091G0JXU
PhylomeDBiQ96AX2
TreeFamiTF323428

Enzyme and pathway databases

ReactomeiR-HSA-6798695 Neutrophil degranulation
R-HSA-8873719 RAB geranylgeranylation

Miscellaneous databases

ChiTaRSiRAB37 human
GeneWikiiRAB37
GenomeRNAii326624
PROiPR:Q96AX2
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000172794 Expressed in 135 organ(s), highest expression level in right hemisphere of cerebellum
CleanExiHS_RAB37
ExpressionAtlasiQ96AX2 baseline and differential
GenevisibleiQ96AX2 HS

Family and domain databases

InterProiView protein in InterPro
IPR027417 P-loop_NTPase
IPR005225 Small_GTP-bd_dom
IPR001806 Small_GTPase
PfamiView protein in Pfam
PF00071 Ras, 1 hit
SUPFAMiSSF52540 SSF52540, 1 hit
TIGRFAMsiTIGR00231 small_GTP, 1 hit
PROSITEiView protein in PROSITE
PS51419 RAB, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiRAB37_HUMAN
AccessioniPrimary (citable) accession number: Q96AX2
Secondary accession number(s): A8MXF5, A8MYT0, Q8IWA7
Entry historyiIntegrated into UniProtKB/Swiss-Prot: January 31, 2002
Last sequence update: January 23, 2007
Last modified: November 7, 2018
This is version 159 of the entry and version 3 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. Human chromosome 17
    Human chromosome 17: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again