Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

SOSS complex subunit B2

Gene

NABP1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Component of the SOSS complex, a multiprotein complex that functions downstream of the MRN complex to promote DNA repair and G2/M checkpoint. In the SOSS complex, acts as a sensor of single-stranded DNA that binds to single-stranded DNA, in particular to polypyrimidines. The SOSS complex associates with DNA lesions and influences diverse endpoints in the cellular DNA damage response including cell-cycle checkpoint activation, recombinational repair and maintenance of genomic stability. Required for efficient homologous recombination-dependent repair of double-strand breaks (DSBs) and ATM-dependent signaling pathways.2 Publications

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
DNA bindingi26 – 99OBAdd BLAST74

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionDNA-binding
Biological processDNA damage, DNA repair

Enzyme and pathway databases

ReactomeiR-HSA-6807505 RNA polymerase II transcribes snRNA genes

Names & Taxonomyi

Protein namesi
Recommended name:
SOSS complex subunit B2
Alternative name(s):
Nucleic acid-binding protein 1
Oligonucleotide/oligosaccharide-binding fold-containing protein 2A
Sensor of single-strand DNA complex subunit B2
Sensor of ssDNA subunit B2
Short name:
SOSS-B2
Single-stranded DNA-binding protein 2
Short name:
hSSB2
Gene namesi
Name:NABP1
Synonyms:OBFC2A, SSB2
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 2

Organism-specific databases

EuPathDBiHostDB:ENSG00000173559.12
HGNCiHGNC:26232 NABP1
MIMi612103 gene
neXtProtiNX_Q96AH0

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Organism-specific databases

DisGeNETi64859
MalaCardsiNABP1
OpenTargetsiENSG00000173559
Orphaneti520 Acute promyelocytic leukemia
PharmGKBiPA143485566

Polymorphism and mutation databases

BioMutaiNABP1
DMDMi74760705

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00003339541 – 204SOSS complex subunit B2Add BLAST204

Proteomic databases

EPDiQ96AH0
MaxQBiQ96AH0
PaxDbiQ96AH0
PeptideAtlasiQ96AH0
PRIDEiQ96AH0
ProteomicsDBi75963
75964 [Q96AH0-2]
75965 [Q96AH0-3]

PTM databases

iPTMnetiQ96AH0
PhosphoSitePlusiQ96AH0

Expressioni

Gene expression databases

BgeeiENSG00000173559 Expressed in 191 organ(s), highest expression level in amniotic fluid
CleanExiHS_OBFC2A
ExpressionAtlasiQ96AH0 baseline and differential
GenevisibleiQ96AH0 HS

Organism-specific databases

HPAiHPA054978
HPA067802

Interactioni

Subunit structurei

Component of the SOSS complex, composed of SOSS-B (SOSS-B1/NABP2 or SOSS-B2/NABP1), SOSS-A/INTS3 and SOSS-C/INIP. SOSS complexes containing SOSS-B1/NABP2 are more abundant than complexes containing SOSS-B2/NABP1.2 Publications

Binary interactionsi

Protein-protein interaction databases

BioGridi122332, 18 interactors
ComplexPortaliCPX-614 SOSS2 complex
IntActiQ96AH0, 21 interactors
STRINGi9606.ENSP00000403683

Structurei

3D structure databases

ProteinModelPortaliQ96AH0
SMRiQ96AH0
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the SOSS-B family. SOSS-B2 subfamily.Curated

Phylogenomic databases

eggNOGiKOG3416 Eukaryota
ENOG4111MBP LUCA
GeneTreeiENSGT00390000001913
HOGENOMiHOG000006622
InParanoidiQ96AH0
OMAiGYASLWK
OrthoDBiEOG091G0YHH
PhylomeDBiQ96AH0
TreeFamiTF313902

Family and domain databases

InterProiView protein in InterPro
IPR012340 NA-bd_OB-fold
SUPFAMiSSF50249 SSF50249, 1 hit

Sequences (3+)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q96AH0-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MNRVNDPLIF IRDIKPGLKN LNVVFIVLEI GRVTKTKDGH EVRSCKVADK
60 70 80 90 100
TGSITISVWD EIGGLIQPGD IIRLTRGYAS MWKGCLTLYT GRGGELQKIG
110 120 130 140 150
EFCMVYSEVP NFSEPNPDYR GQQNKGAQSE QKNNSMNSNM GTGTFGPVGN
160 170 180 190 200
GVHTGPESRE HQFSHAGRSN GRGLINPQLQ GTASNQTVMT TISNGRDPRR

AFKR
Length:204
Mass (Da):22,423
Last modified:December 1, 2001 - v1
Checksum:iEF7579A452381E47
GO
Isoform 2 (identifier: Q96AH0-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-80: Missing.

Show »
Length:124
Mass (Da):13,579
Checksum:i285E087256426CAC
GO
Isoform 3 (identifier: Q96AH0-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     101-134: EFCMVYSEVPNFSEPNPDYRGQQNKGAQSEQKNN → DLGAVQAAAMRDSIHYYPGNDLHPDLEEPSSLGV
     135-204: Missing.

Show »
Length:134
Mass (Da):14,677
Checksum:i9243CCF90A5E06E2
GO

Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H7C0W4H7C0W4_HUMAN
SOSS complex subunit B2
NABP1
168Annotation score:
F8WAF5F8WAF5_HUMAN
SOSS complex subunit B2
NABP1
54Annotation score:

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_043340154T → S. Corresponds to variant dbSNP:rs12612256Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0336001 – 80Missing in isoform 2. 2 PublicationsAdd BLAST80
Alternative sequenceiVSP_033601101 – 134EFCMV…EQKNN → DLGAVQAAAMRDSIHYYPGN DLHPDLEEPSSLGV in isoform 3. 1 PublicationAdd BLAST34
Alternative sequenceiVSP_033602135 – 204Missing in isoform 3. 1 PublicationAdd BLAST70

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK026486 mRNA Translation: BAB15491.1
AL832659 mRNA Translation: CAH56209.1
AC114778 Genomic DNA Translation: AAY24348.1
CH471058 Genomic DNA Translation: EAX10836.1
CH471058 Genomic DNA Translation: EAX10837.1
CH471058 Genomic DNA Translation: EAX10838.1
BC017114 mRNA Translation: AAH17114.1
BC107723 mRNA Translation: AAI07724.1
CCDSiCCDS33352.1 [Q96AH0-1]
CCDS58745.1 [Q96AH0-2]
RefSeqiNP_001026886.1, NM_001031716.2 [Q96AH0-1]
NP_001241665.1, NM_001254736.1 [Q96AH0-2]
XP_016860211.1, XM_017004722.1 [Q96AH0-3]
UniGeneiHs.591610

Genome annotation databases

EnsembliENST00000307849; ENSP00000307968; ENSG00000173559 [Q96AH0-3]
ENST00000409510; ENSP00000386605; ENSG00000173559 [Q96AH0-2]
ENST00000410026; ENSP00000387243; ENSG00000173559 [Q96AH0-2]
ENST00000425611; ENSP00000403683; ENSG00000173559 [Q96AH0-1]
ENST00000451500; ENSP00000390901; ENSG00000173559 [Q96AH0-3]
GeneIDi64859
KEGGihsa:64859
UCSCiuc002usw.4 human [Q96AH0-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK026486 mRNA Translation: BAB15491.1
AL832659 mRNA Translation: CAH56209.1
AC114778 Genomic DNA Translation: AAY24348.1
CH471058 Genomic DNA Translation: EAX10836.1
CH471058 Genomic DNA Translation: EAX10837.1
CH471058 Genomic DNA Translation: EAX10838.1
BC017114 mRNA Translation: AAH17114.1
BC107723 mRNA Translation: AAI07724.1
CCDSiCCDS33352.1 [Q96AH0-1]
CCDS58745.1 [Q96AH0-2]
RefSeqiNP_001026886.1, NM_001031716.2 [Q96AH0-1]
NP_001241665.1, NM_001254736.1 [Q96AH0-2]
XP_016860211.1, XM_017004722.1 [Q96AH0-3]
UniGeneiHs.591610

3D structure databases

ProteinModelPortaliQ96AH0
SMRiQ96AH0
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi122332, 18 interactors
ComplexPortaliCPX-614 SOSS2 complex
IntActiQ96AH0, 21 interactors
STRINGi9606.ENSP00000403683

PTM databases

iPTMnetiQ96AH0
PhosphoSitePlusiQ96AH0

Polymorphism and mutation databases

BioMutaiNABP1
DMDMi74760705

Proteomic databases

EPDiQ96AH0
MaxQBiQ96AH0
PaxDbiQ96AH0
PeptideAtlasiQ96AH0
PRIDEiQ96AH0
ProteomicsDBi75963
75964 [Q96AH0-2]
75965 [Q96AH0-3]

Protocols and materials databases

DNASUi64859
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000307849; ENSP00000307968; ENSG00000173559 [Q96AH0-3]
ENST00000409510; ENSP00000386605; ENSG00000173559 [Q96AH0-2]
ENST00000410026; ENSP00000387243; ENSG00000173559 [Q96AH0-2]
ENST00000425611; ENSP00000403683; ENSG00000173559 [Q96AH0-1]
ENST00000451500; ENSP00000390901; ENSG00000173559 [Q96AH0-3]
GeneIDi64859
KEGGihsa:64859
UCSCiuc002usw.4 human [Q96AH0-1]

Organism-specific databases

CTDi64859
DisGeNETi64859
EuPathDBiHostDB:ENSG00000173559.12
GeneCardsiNABP1
H-InvDBiHIX0002686
HGNCiHGNC:26232 NABP1
HPAiHPA054978
HPA067802
MalaCardsiNABP1
MIMi612103 gene
neXtProtiNX_Q96AH0
OpenTargetsiENSG00000173559
Orphaneti520 Acute promyelocytic leukemia
PharmGKBiPA143485566
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG3416 Eukaryota
ENOG4111MBP LUCA
GeneTreeiENSGT00390000001913
HOGENOMiHOG000006622
InParanoidiQ96AH0
OMAiGYASLWK
OrthoDBiEOG091G0YHH
PhylomeDBiQ96AH0
TreeFamiTF313902

Enzyme and pathway databases

ReactomeiR-HSA-6807505 RNA polymerase II transcribes snRNA genes

Miscellaneous databases

ChiTaRSiNABP1 human
GenomeRNAii64859
PROiPR:Q96AH0
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000173559 Expressed in 191 organ(s), highest expression level in amniotic fluid
CleanExiHS_OBFC2A
ExpressionAtlasiQ96AH0 baseline and differential
GenevisibleiQ96AH0 HS

Family and domain databases

InterProiView protein in InterPro
IPR012340 NA-bd_OB-fold
SUPFAMiSSF50249 SSF50249, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiSOSB2_HUMAN
AccessioniPrimary (citable) accession number: Q96AH0
Secondary accession number(s): Q658Y8, Q9H5X6
Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 20, 2008
Last sequence update: December 1, 2001
Last modified: November 7, 2018
This is version 137 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again