Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 143 (11 Dec 2019)
Sequence version 1 (01 Dec 2001)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Tetratricopeptide repeat protein 17

Gene

TTC17

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Plays a role in primary ciliogenesis by modulating actin polymerization.1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processCilium biogenesis/degradation

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Tetratricopeptide repeat protein 17
Short name:
TPR repeat protein 17
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:TTC17
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 11

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000052841.14

Human Gene Nomenclature Database

More...
HGNCi
HGNC:25596 TTC17

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q96AE7

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell membrane, Cytoplasm, Cytoskeleton, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
55761

Open Targets

More...
OpenTargetsi
ENSG00000052841

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA134912435

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q96AE7 Tdark

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
TTC17

Domain mapping of disease mutations (DMDM)

More...
DMDMi
52783467

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001064061 – 1141Tetratricopeptide repeat protein 17Add BLAST1141

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q96AE7

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q96AE7

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q96AE7

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q96AE7

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q96AE7

PeptideAtlas

More...
PeptideAtlasi
Q96AE7

PRoteomics IDEntifications database

More...
PRIDEi
Q96AE7

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
33701
75960 [Q96AE7-1]

PTM databases

GlyConnect protein glycosylation platform

More...
GlyConnecti
1799

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q96AE7

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q96AE7

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in germ cells as well as in somatic cells of the testis (at protein level).1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000052841 Expressed in 220 organ(s), highest expression level in lung

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q96AE7 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q96AE7 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA038508

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with CATIP.

1 Publication

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
120879, 36 interactors

Protein interaction database and analysis system

More...
IntActi
Q96AE7, 27 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000039989

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q96AE7 protein

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati295 – 328TPR 1Add BLAST34
Repeati619 – 652TPR 2Add BLAST34
Repeati689 – 722TPR 3Add BLAST34
Repeati1014 – 1048TPR 4Add BLAST35
Repeati1051 – 1084TPR 5Add BLAST34
Repeati1085 – 1118TPR 6Add BLAST34

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and domains’ section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili340 – 382Sequence analysisAdd BLAST43

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the TTC17 family.Curated

Keywords - Domaini

Coiled coil, Repeat, TPR repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG4507 Eukaryota
ENOG410XSDX LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000006196

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000231397

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q96AE7

Identification of Orthologs from Complete Genome Data

More...
OMAi
PFRINTF

Database of Orthologous Groups

More...
OrthoDBi
310025at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q96AE7

TreeFam database of animal gene trees

More...
TreeFami
TF315005

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.25.40.10, 3 hits

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR013026 TPR-contain_dom
IPR011990 TPR-like_helical_dom_sf
IPR019734 TPR_repeat

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF13181 TPR_8, 2 hits

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00028 TPR, 7 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF48452 SSF48452, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50005 TPR, 4 hits
PS50293 TPR_REGION, 3 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q96AE7-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAAAVGVRGR YELPPCSGPG WLLSLSALLS VAARGAFATT HWVVTEDGKI
60 70 80 90 100
QQQVDSPMNL KHPHDLVILM RQEATVNYLK ELEKQLVAQK IHIEENEDRD
110 120 130 140 150
TGLEQRHNKE DPDCIKAKVP LGDLDLYDGT YITLESKDIS PEDYIDTESP
160 170 180 190 200
VPPDPEQPDC TKILELPYSI HAFQHLRGVQ ERVNLSAPLL PKEDPIFTYL
210 220 230 240 250
SKRLGRSIDD IGHLIHEGLQ KNTSSWVLYN MASFYWRIKN EPYQVVECAM
260 270 280 290 300
RALHFSSRHN KDIALVNLAN VLHRAHFSAD AAVVVHAALD DSDFFTSYYT
310 320 330 340 350
LGNIYAMLGE YNHSVLCYDH ALQARPGFEQ AIKRKHAVLC QQKLEQKLEA
360 370 380 390 400
QHRSLQRTLN ELKEYQKQHD HYLRQQEILE KHKLIQEEQI LRNIIHETQM
410 420 430 440 450
AKEAQLGNHQ ICRLVNQQHS LHCQWDQPVR YHRGDIFENV DYVQFGEDSS
460 470 480 490 500
TSSMMSVNFD VQSNQSDIND SVKSSPVAHS ILWIWGRDSD AYRDKQHILW
510 520 530 540 550
PKRADCTESY PRVPVGGELP TYFLPPENKG LRIHELSSDD YSTEEEAQTP
560 570 580 590 600
DCSITDFRKS HTLSYLVKEL EVRMDLKAKM PDDHARKILL SRINNYTIPE
610 620 630 640 650
EEIGSFLFHA INKPNAPIWL ILNEAGLYWR AVGNSTFAIA CLQRALNLAP
660 670 680 690 700
LQYQDVPLVN LANLLIHYGL HLDATKLLLQ ALAINSSEPL TFLSLGNAYL
710 720 730 740 750
ALKNISGALE AFRQALKLTT KCPECENSLK LIRCMQFYPF LYNITSSVCS
760 770 780 790 800
GTVVEESNGS DEMENSDETK MSEEILALVD EFQQAWPLEG FGGALEMKGR
810 820 830 840 850
RLDLQGIRVL KKGPQDGVAR SSCYGDCRSE DDEATEWITF QVKRVKKPKG
860 870 880 890 900
DHKKTPGKKV ETGQIENGHR YQANLEITGP KVASPGPQGK KRDYQRLGWP
910 920 930 940 950
SPDECLKLRW VELTAIVSTW LAVSSKNIDI TEHIDFATPI QQPAMEPLCN
960 970 980 990 1000
GNLPTSMHTL DHLHGVSNRA SLHYTGESQL TEVLQNLGKD QYPQQSLEQI
1010 1020 1030 1040 1050
GTRIAKVLEK NQTSWVLSSM AALYWRVKGQ GKKAIDCLRQ ALHYAPHQMK
1060 1070 1080 1090 1100
DVPLISLANI LHNAKLWNDA VIVATMAVEI APHFAVNHFT LGNVYVAMEE
1110 1120 1130 1140
FEKALVWYES TLKLQPEFVP AKNRIQTIQC HLMLKKGRRS P
Length:1,141
Mass (Da):129,558
Last modified:December 1, 2001 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i728A031FED8BDE3E
GO
Isoform 2 (identifier: Q96AE7-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     751-751: G → GNCHEKTLDNSHDKQKYFDNSQSLDAAEEEPSERGTEEDPVFSVENSGRDSDALRLES
     890-898: KKRDYQRLG → LLDWKTRKV
     899-1140: Missing.

Show »
Length:956
Mass (Da):108,613
Checksum:iC608CAFE900AAE1D
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H0Y6S0H0Y6S0_HUMAN
Tetratricopeptide repeat protein 17
TTC17
172Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A075B7B2A0A075B7B2_HUMAN
Tetratricopeptide repeat protein 17
TTC17
140Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PN79E9PN79_HUMAN
Tetratricopeptide repeat protein 17
TTC17
54Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Isoform 2 (identifier: Q96AE7-2)
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti787E → G in AAH33000 (PubMed:15489334).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_034135145I → L. Corresponds to variant dbSNP:rs12099204Ensembl.1
Natural variantiVAR_052627270N → H. Corresponds to variant dbSNP:rs16937479Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_056857751G → GNCHEKTLDNSHDKQKYFDN SQSLDAAEEEPSERGTEEDP VFSVENSGRDSDALRLES in isoform 2. 1 Publication1
Alternative sequenceiVSP_056858890 – 898KKRDYQRLG → LLDWKTRKV in isoform 2. 1 Publication9
Alternative sequenceiVSP_056859899 – 1140Missing in isoform 2. 1 PublicationAdd BLAST242

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AC023085 Genomic DNA No translation available.
AC087276 Genomic DNA No translation available.
CH471064 Genomic DNA Translation: EAW68094.1
BC017238 mRNA Translation: AAH17238.1
BC033000 mRNA Translation: AAH33000.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS31466.1 [Q96AE7-1]
CCDS76396.1 [Q96AE7-2]

NCBI Reference Sequences

More...
RefSeqi
NP_001294872.1, NM_001307943.1 [Q96AE7-2]
NP_060729.2, NM_018259.5 [Q96AE7-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000039989; ENSP00000039989; ENSG00000052841 [Q96AE7-1]
ENST00000299240; ENSP00000299240; ENSG00000052841 [Q96AE7-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
55761

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:55761

UCSC genome browser

More...
UCSCi
uc001mxh.4 human [Q96AE7-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AC023085 Genomic DNA No translation available.
AC087276 Genomic DNA No translation available.
CH471064 Genomic DNA Translation: EAW68094.1
BC017238 mRNA Translation: AAH17238.1
BC033000 mRNA Translation: AAH33000.1
CCDSiCCDS31466.1 [Q96AE7-1]
CCDS76396.1 [Q96AE7-2]
RefSeqiNP_001294872.1, NM_001307943.1 [Q96AE7-2]
NP_060729.2, NM_018259.5 [Q96AE7-1]

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

BioGridi120879, 36 interactors
IntActiQ96AE7, 27 interactors
STRINGi9606.ENSP00000039989

PTM databases

GlyConnecti1799
iPTMnetiQ96AE7
PhosphoSitePlusiQ96AE7

Polymorphism and mutation databases

BioMutaiTTC17
DMDMi52783467

Proteomic databases

EPDiQ96AE7
jPOSTiQ96AE7
MassIVEiQ96AE7
MaxQBiQ96AE7
PaxDbiQ96AE7
PeptideAtlasiQ96AE7
PRIDEiQ96AE7
ProteomicsDBi33701
75960 [Q96AE7-1]

Genome annotation databases

EnsembliENST00000039989; ENSP00000039989; ENSG00000052841 [Q96AE7-1]
ENST00000299240; ENSP00000299240; ENSG00000052841 [Q96AE7-2]
GeneIDi55761
KEGGihsa:55761
UCSCiuc001mxh.4 human [Q96AE7-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
55761
DisGeNETi55761
EuPathDBiHostDB:ENSG00000052841.14

GeneCards: human genes, protein and diseases

More...
GeneCardsi
TTC17
HGNCiHGNC:25596 TTC17
HPAiHPA038508
neXtProtiNX_Q96AE7
OpenTargetsiENSG00000052841
PharmGKBiPA134912435

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG4507 Eukaryota
ENOG410XSDX LUCA
GeneTreeiENSGT00390000006196
HOGENOMiHOG000231397
InParanoidiQ96AE7
OMAiPFRINTF
OrthoDBi310025at2759
PhylomeDBiQ96AE7
TreeFamiTF315005

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
TTC17 human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
55761
PharosiQ96AE7 Tdark

Protein Ontology

More...
PROi
PR:Q96AE7
RNActiQ96AE7 protein

Gene expression databases

BgeeiENSG00000052841 Expressed in 220 organ(s), highest expression level in lung
ExpressionAtlasiQ96AE7 baseline and differential
GenevisibleiQ96AE7 HS

Family and domain databases

Gene3Di1.25.40.10, 3 hits
InterProiView protein in InterPro
IPR013026 TPR-contain_dom
IPR011990 TPR-like_helical_dom_sf
IPR019734 TPR_repeat
PfamiView protein in Pfam
PF13181 TPR_8, 2 hits
SMARTiView protein in SMART
SM00028 TPR, 7 hits
SUPFAMiSSF48452 SSF48452, 1 hit
PROSITEiView protein in PROSITE
PS50005 TPR, 4 hits
PS50293 TPR_REGION, 3 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiTTC17_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q96AE7
Secondary accession number(s): G3XAB3, Q8NEC0
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: September 27, 2004
Last sequence update: December 1, 2001
Last modified: December 11, 2019
This is version 143 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. Human chromosome 11
    Human chromosome 11: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again