Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Janus kinase and microtubule-interacting protein 2

Gene

JAKMIP2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Janus kinase and microtubule-interacting protein 2
Alternative name(s):
CTCL tumor antigen HD-CL-04
Neuroendocrine long coiled-coil protein 1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:JAKMIP2
Synonyms:JAMIP2, KIAA0555, NECC1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 5

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000176049.15

Human Gene Nomenclature Database

More...
HGNCi
HGNC:29067 JAKMIP2

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
611197 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q96AA8

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Golgi apparatus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
9832

Open Targets

More...
OpenTargetsi
ENSG00000176049

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA143485509

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
JAKMIP2

Domain mapping of disease mutations (DMDM)

More...
DMDMi
20140696

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000507621 – 810Janus kinase and microtubule-interacting protein 2Add BLAST810

Proteomic databases

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q96AA8

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q96AA8

PeptideAtlas

More...
PeptideAtlasi
Q96AA8

PRoteomics IDEntifications database

More...
PRIDEi
Q96AA8

ProteomicsDB human proteome resource

More...
ProteomicsDBi
75942
75943 [Q96AA8-2]
75944 [Q96AA8-3]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q96AA8

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q96AA8

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Highly expressed in brain, moderately expressed in thymus, spleen and lung, and weakly expressed in kidney, liver and peripheral blood lymphocytes. Also expressed in adrenal and pituitary glands, as well as testis.2 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000176049 Expressed in 141 organ(s), highest expression level in corpus callosum

CleanEx database of gene expression profiles

More...
CleanExi
HS_JAKMIP2

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q96AA8 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA046929
HPA065023

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
115170, 16 interactors

Protein interaction database and analysis system

More...
IntActi
Q96AA8, 18 interactors

Molecular INTeraction database

More...
MINTi
Q96AA8

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000265272

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q96AA8

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and domains’ section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili13 – 102Sequence analysisAdd BLAST90
Coiled coili148 – 178Sequence analysisAdd BLAST31
Coiled coili207 – 244Sequence analysisAdd BLAST38
Coiled coili280 – 419Sequence analysisAdd BLAST140
Coiled coili468 – 597Sequence analysisAdd BLAST130
Coiled coili664 – 808Sequence analysisAdd BLAST145

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the JAKMIP family.Curated

Keywords - Domaini

Coiled coil

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410II6X Eukaryota
ENOG4110F4A LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000153713

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000060161

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG054249

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q96AA8

Identification of Orthologs from Complete Genome Data

More...
OMAi
CLTKRND

Database of Orthologous Groups

More...
OrthoDBi
EOG091G024X

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q96AA8

TreeFam database of animal gene trees

More...
TreeFami
TF331900

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR024836 JAKMIP
IPR031994 JAKMIP_C

The PANTHER Classification System

More...
PANTHERi
PTHR18935 PTHR18935, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF16034 JAKMIP_CC3, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q96AA8-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSKKGRNKGE KPEALIVALQ AANEDLRTKL TDIQIELHQE KSKVSKLERE
60 70 80 90 100
KTQEAKRIRE LEQRKHTVLV TELKAKLHEE KMKELQAVRE NLIKQHEQEM
110 120 130 140 150
SRTVKVRDGE IQRLKSALCA LRDGSSDKVR TALTIEAREE ARKLFDTERL
160 170 180 190 200
KLLQEIADLK TAKKQVDEAL SNMIQADKIK AGDLRSEHQS HQEAISKIKW
210 220 230 240 250
ESERDIRRLM DEIKAKDRII FSLEKELETQ TGYVQKLQLQ KEALDEQLFL
260 270 280 290 300
VKEAECNMSS PKREIPGRAG DGSEHCSSPD LRRNQKRIAE LNATIRKLED
310 320 330 340 350
RNTLLGDERN ELLKRVRETE KQCKPLLERN KCLAKRNDEL MVSLQRMEEK
360 370 380 390 400
LKAVTKENSE MREKITSHPP LKKLKSLNDL DQANEEQETE FLKLQVIEQQ
410 420 430 440 450
NIIDELTRDR EKLIRRRKHR RSSKPIKRPV LDPFIGYDED SMDSETSSMA
460 470 480 490 500
SFRTDRTPAT PDDDLDESLA AEESELRFRQ LTKEYQALQR AYALLQEQTG
510 520 530 540 550
GIIDAEREAK AQEQLQAEVL RYKAKIEDLE ATLAQKGQDS HWVEDKQLFI
560 570 580 590 600
KRNQELLEKI EKQEAENHRL QQELQDARDQ NELLEFRNLE LEERERRSPP
610 620 630 640 650
FNLQIHPFSD GVSALQIYCM KEGVKDVNIP DLIKQLDILG DNGNLRNEEQ
660 670 680 690 700
VAIIQASTVL SLAEKWIQQI EGAEAALHQK MMELESDMEQ FCKIKGYLEE
710 720 730 740 750
ELDYRKQALD QAYMRIQELE ATLYNALQQE TVIKFGELLS EKQQEELRTA
760 770 780 790 800
VEKLRRQMLR KSREYDCQIL QERMELLQQA HQRIRDLEDK TDIQKRQIKD
810
LEEKSNRKHG
Length:810
Mass (Da):94,934
Last modified:December 1, 2001 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iD81480AD76DA6A10
GO
Isoform 2 (identifier: Q96AA8-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     539-559: Missing.
     805-810: SNRKHG → FLFLFLFFSLAFILWP

Show »
Length:799
Mass (Da):93,620
Checksum:i40CD6861B348F2C4
GO
Isoform 3 (identifier: Q96AA8-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     805-810: SNRKHG → FLFLFLFFSLAFILWP

Show »
Length:820
Mass (Da):96,258
Checksum:i7C1D5257F1E325AE
GO
Isoform 4 (identifier: Q96AA8-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-43: MSKKGRNKGEKPEALIVALQAANEDLRTKLTDIQIELHQEKSK → M
     805-810: SNRKHG → FLFLFLFFSLAFILWP

Note: No experimental confirmation available.
Show »
Length:778
Mass (Da):91,546
Checksum:i452F8ED6B1F72BA4
GO

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAA25481 differs from that shown. Reason: Frameshift at position 805.Curated

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_022059106V → I. Corresponds to variant dbSNP:rs3749736Ensembl.1
Natural variantiVAR_035930315R → C in a colorectal cancer sample; somatic mutation. 1 PublicationCorresponds to variant dbSNP:rs761359853Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0552641 – 43MSKKG…QEKSK → M in isoform 4. 1 PublicationAdd BLAST43
Alternative sequenceiVSP_002430539 – 559Missing in isoform 2. 1 PublicationAdd BLAST21
Alternative sequenceiVSP_028230805 – 810SNRKHG → FLFLFLFFSLAFILWP in isoform 2, isoform 3 and isoform 4. 3 Publications6

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AK291280 mRNA Translation: BAF83969.1
AK299724 mRNA Translation: BAG61622.1
EF512550 mRNA Translation: ABP62932.1
AF273057 mRNA Translation: AAM44460.1
AB011127 mRNA Translation: BAA25481.2 Frameshift.
AC011370 Genomic DNA No translation available.
AC011415 Genomic DNA No translation available.
AC126775 Genomic DNA No translation available.
CH471062 Genomic DNA Translation: EAW61820.1
CH471062 Genomic DNA Translation: EAW61821.1
BC017354 mRNA Translation: AAH17354.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS4285.1 [Q96AA8-1]
CCDS59495.1 [Q96AA8-2]
CCDS64284.1 [Q96AA8-4]
CCDS75352.1 [Q96AA8-3]

Protein sequence database of the Protein Information Resource

More...
PIRi
T00331

NCBI Reference Sequences

More...
RefSeqi
NP_001257863.1, NM_001270934.1 [Q96AA8-2]
NP_001257870.1, NM_001270941.1 [Q96AA8-3]
NP_001269211.1, NM_001282282.1 [Q96AA8-4]
NP_055605.2, NM_014790.4 [Q96AA8-1]
XP_016865586.1, XM_017010097.1

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.740461
Hs.744926

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000265272; ENSP00000265272; ENSG00000176049 [Q96AA8-1]
ENST00000333010; ENSP00000328989; ENSG00000176049 [Q96AA8-4]
ENST00000507386; ENSP00000421398; ENSG00000176049 [Q96AA8-2]
ENST00000616793; ENSP00000479248; ENSG00000176049 [Q96AA8-3]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
9832

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:9832

UCSC genome browser

More...
UCSCi
uc003loq.3 human [Q96AA8-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK291280 mRNA Translation: BAF83969.1
AK299724 mRNA Translation: BAG61622.1
EF512550 mRNA Translation: ABP62932.1
AF273057 mRNA Translation: AAM44460.1
AB011127 mRNA Translation: BAA25481.2 Frameshift.
AC011370 Genomic DNA No translation available.
AC011415 Genomic DNA No translation available.
AC126775 Genomic DNA No translation available.
CH471062 Genomic DNA Translation: EAW61820.1
CH471062 Genomic DNA Translation: EAW61821.1
BC017354 mRNA Translation: AAH17354.1
CCDSiCCDS4285.1 [Q96AA8-1]
CCDS59495.1 [Q96AA8-2]
CCDS64284.1 [Q96AA8-4]
CCDS75352.1 [Q96AA8-3]
PIRiT00331
RefSeqiNP_001257863.1, NM_001270934.1 [Q96AA8-2]
NP_001257870.1, NM_001270941.1 [Q96AA8-3]
NP_001269211.1, NM_001282282.1 [Q96AA8-4]
NP_055605.2, NM_014790.4 [Q96AA8-1]
XP_016865586.1, XM_017010097.1
UniGeneiHs.740461
Hs.744926

3D structure databases

SMRiQ96AA8
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi115170, 16 interactors
IntActiQ96AA8, 18 interactors
MINTiQ96AA8
STRINGi9606.ENSP00000265272

PTM databases

iPTMnetiQ96AA8
PhosphoSitePlusiQ96AA8

Polymorphism and mutation databases

BioMutaiJAKMIP2
DMDMi20140696

Proteomic databases

MaxQBiQ96AA8
PaxDbiQ96AA8
PeptideAtlasiQ96AA8
PRIDEiQ96AA8
ProteomicsDBi75942
75943 [Q96AA8-2]
75944 [Q96AA8-3]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000265272; ENSP00000265272; ENSG00000176049 [Q96AA8-1]
ENST00000333010; ENSP00000328989; ENSG00000176049 [Q96AA8-4]
ENST00000507386; ENSP00000421398; ENSG00000176049 [Q96AA8-2]
ENST00000616793; ENSP00000479248; ENSG00000176049 [Q96AA8-3]
GeneIDi9832
KEGGihsa:9832
UCSCiuc003loq.3 human [Q96AA8-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
9832
DisGeNETi9832
EuPathDBiHostDB:ENSG00000176049.15

GeneCards: human genes, protein and diseases

More...
GeneCardsi
JAKMIP2
HGNCiHGNC:29067 JAKMIP2
HPAiHPA046929
HPA065023
MIMi611197 gene
neXtProtiNX_Q96AA8
OpenTargetsiENSG00000176049
PharmGKBiPA143485509

Human Unidentified Gene-Encoded large proteins database

More...
HUGEi
Search...

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410II6X Eukaryota
ENOG4110F4A LUCA
GeneTreeiENSGT00940000153713
HOGENOMiHOG000060161
HOVERGENiHBG054249
InParanoidiQ96AA8
OMAiCLTKRND
OrthoDBiEOG091G024X
PhylomeDBiQ96AA8
TreeFamiTF331900

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
JAKMIP2 human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
9832

Protein Ontology

More...
PROi
PR:Q96AA8

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000176049 Expressed in 141 organ(s), highest expression level in corpus callosum
CleanExiHS_JAKMIP2
GenevisibleiQ96AA8 HS

Family and domain databases

InterProiView protein in InterPro
IPR024836 JAKMIP
IPR031994 JAKMIP_C
PANTHERiPTHR18935 PTHR18935, 1 hit
PfamiView protein in Pfam
PF16034 JAKMIP_CC3, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiJKIP2_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q96AA8
Secondary accession number(s): A4ZZA7
, A8K5G5, B4DSG0, G5E9Y0, O60302, Q548S1
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: January 23, 2002
Last sequence update: December 1, 2001
Last modified: December 5, 2018
This is version 135 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 5
    Human chromosome 5: entries, gene names and cross-references to MIM
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again