Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 125 (05 Jun 2019)
Sequence version 1 (01 Dec 2001)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Transmembrane protein 106A

Gene

TMEM106A

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Activates macrophages and polarizes them into M1-like macrophages through the activation of the MAPK and NF-kappaB signaling pathway. Upon activation, upregulates the expression of CD80, CD86, CD69 and MHC II on macrophages, and induces the release of pro-inflammatory cytokines such as TNF, IL1B, IL6, CCL2 and nitric oxide (By similarity). May play a role in inhibition of proliferation and migration (PubMed:30456879, PubMed:29131025).By similarity2 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processImmunity, Innate immunity

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Transmembrane protein 106A
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 17

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:28288 TMEM106A

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q96A25

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei95 – 115HelicalSequence analysisAdd BLAST21

Keywords - Cellular componenti

Cell membrane, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
113277

Open Targets

More...
OpenTargetsi
ENSG00000184988

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA142670755

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
TMEM106A

Domain mapping of disease mutations (DMDM)

More...
DMDMi
74731081

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002421371 – 262Transmembrane protein 106AAdd BLAST262

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q96A25

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q96A25

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q96A25

PeptideAtlas

More...
PeptideAtlasi
Q96A25

PRoteomics IDEntifications database

More...
PRIDEi
Q96A25

ProteomicsDB human proteome resource

More...
ProteomicsDBi
75896

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q96A25

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q96A25

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in renal cells (at protein level) (PubMed:29131025). Expressed in epithelial cells (PubMed:30456879).2 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000184988 Expressed in 188 organ(s), highest expression level in cortex of kidney

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q96A25 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q96A25 HS

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
125240, 47 interactors

Protein interaction database and analysis system

More...
IntActi
Q96A25, 12 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000483246

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the TMEM106 family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IJ5J Eukaryota
ENOG410XUHT LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000161546

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000230966

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q96A25

Identification of Orthologs from Complete Genome Data

More...
OMAi
TQLTIEV

Database of Orthologous Groups

More...
OrthoDBi
1175832at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q96A25

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR009790 DUF1356_TMEM106

The PANTHER Classification System

More...
PANTHERi
PTHR28556 PTHR28556, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF07092 DUF1356, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q96A25-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MGKTFSQLGS WREDENKSIL SSKPAIGSKA VNYSSTGSSK SFCSCVPCEG
60 70 80 90 100
TADASFVTCP TCQGSGKIPQ ELEKQLVALI PYGDQRLKPK HTKLFVFLAV
110 120 130 140 150
LICLVTSSFI VFFLFPRSVI VQPAGLNSST VAFDEADIYL NITNILNISN
160 170 180 190 200
GNYYPIMVTQ LTLEVLHLSL VVGQVSNNLL LHIGPLASEQ MFYAVATKIR
210 220 230 240 250
DENTYKICTW LEIKVHHVLL HIQGTLTCSY LSHSEQLVFQ SYEYVDCRGN
260
ASVPHQLTPH PP
Length:262
Mass (Da):28,920
Last modified:December 1, 2001 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i306433230D5E8D8B
GO
Isoform 2 (identifier: Q96A25-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-49: MGKTFSQLGSWREDENKSILSSKPAIGSKAVNYSSTGSSKSFCSCVPCE → M

Note: No experimental confirmation available.
Show »
Length:214
Mass (Da):23,849
Checksum:i6333D07E13D8D9B0
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
B7Z779B7Z779_HUMAN
Transmembrane protein 106A
TMEM106A
215Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
K7ERE2K7ERE2_HUMAN
Transmembrane protein 106A
TMEM106A
241Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0566421 – 49MGKTF…CVPCE → M in isoform 2. 1 PublicationAdd BLAST49

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AK056132 mRNA Translation: BAB71101.1
AK290387 mRNA Translation: BAF83076.1
AK299974 mRNA Translation: BAH13184.1
BC012139 mRNA Translation: AAH12139.1
BC146974 mRNA Translation: AAI46975.1
BC146976 mRNA Translation: AAI46977.1
BC147023 mRNA Translation: AAI47024.1
AC087365 Genomic DNA No translation available.
AC109326 Genomic DNA No translation available.
CH471152 Genomic DNA Translation: EAW60954.1
BC157892 mRNA Translation: AAI57893.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS11462.1 [Q96A25-1]
CCDS74073.1 [Q96A25-2]

NCBI Reference Sequences

More...
RefSeqi
NP_001278515.1, NM_001291586.1 [Q96A25-1]
NP_001278516.1, NM_001291587.1 [Q96A25-2]
NP_659478.1, NM_145041.3 [Q96A25-1]
XP_006721721.1, XM_006721658.2 [Q96A25-1]
XP_006721722.1, XM_006721659.3 [Q96A25-2]
XP_016879603.1, XM_017024114.1 [Q96A25-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000541594; ENSP00000439844; ENSG00000184988 [Q96A25-2]
ENST00000588659; ENSP00000466820; ENSG00000184988 [Q96A25-1]
ENST00000612339; ENSP00000483246; ENSG00000184988 [Q96A25-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
113277

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:113277

UCSC genome browser

More...
UCSCi
uc002idn.2 human [Q96A25-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK056132 mRNA Translation: BAB71101.1
AK290387 mRNA Translation: BAF83076.1
AK299974 mRNA Translation: BAH13184.1
BC012139 mRNA Translation: AAH12139.1
BC146974 mRNA Translation: AAI46975.1
BC146976 mRNA Translation: AAI46977.1
BC147023 mRNA Translation: AAI47024.1
AC087365 Genomic DNA No translation available.
AC109326 Genomic DNA No translation available.
CH471152 Genomic DNA Translation: EAW60954.1
BC157892 mRNA Translation: AAI57893.1
CCDSiCCDS11462.1 [Q96A25-1]
CCDS74073.1 [Q96A25-2]
RefSeqiNP_001278515.1, NM_001291586.1 [Q96A25-1]
NP_001278516.1, NM_001291587.1 [Q96A25-2]
NP_659478.1, NM_145041.3 [Q96A25-1]
XP_006721721.1, XM_006721658.2 [Q96A25-1]
XP_006721722.1, XM_006721659.3 [Q96A25-2]
XP_016879603.1, XM_017024114.1 [Q96A25-2]

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

BioGridi125240, 47 interactors
IntActiQ96A25, 12 interactors
STRINGi9606.ENSP00000483246

PTM databases

iPTMnetiQ96A25
PhosphoSitePlusiQ96A25

Polymorphism and mutation databases

BioMutaiTMEM106A
DMDMi74731081

Proteomic databases

jPOSTiQ96A25
MaxQBiQ96A25
PaxDbiQ96A25
PeptideAtlasiQ96A25
PRIDEiQ96A25
ProteomicsDBi75896

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
113277
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000541594; ENSP00000439844; ENSG00000184988 [Q96A25-2]
ENST00000588659; ENSP00000466820; ENSG00000184988 [Q96A25-1]
ENST00000612339; ENSP00000483246; ENSG00000184988 [Q96A25-1]
GeneIDi113277
KEGGihsa:113277
UCSCiuc002idn.2 human [Q96A25-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
113277
DisGeNETi113277

GeneCards: human genes, protein and diseases

More...
GeneCardsi
TMEM106A
HGNCiHGNC:28288 TMEM106A
neXtProtiNX_Q96A25
OpenTargetsiENSG00000184988
PharmGKBiPA142670755

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410IJ5J Eukaryota
ENOG410XUHT LUCA
GeneTreeiENSGT00940000161546
HOGENOMiHOG000230966
InParanoidiQ96A25
OMAiTQLTIEV
OrthoDBi1175832at2759
PhylomeDBiQ96A25

Miscellaneous databases

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
TMEM106A

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
113277

Protein Ontology

More...
PROi
PR:Q96A25

Gene expression databases

BgeeiENSG00000184988 Expressed in 188 organ(s), highest expression level in cortex of kidney
ExpressionAtlasiQ96A25 baseline and differential
GenevisibleiQ96A25 HS

Family and domain databases

InterProiView protein in InterPro
IPR009790 DUF1356_TMEM106
PANTHERiPTHR28556 PTHR28556, 1 hit
PfamiView protein in Pfam
PF07092 DUF1356, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiT106A_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q96A25
Secondary accession number(s): A8K2X2, B7Z698
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: June 27, 2006
Last sequence update: December 1, 2001
Last modified: June 5, 2019
This is version 125 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 17
    Human chromosome 17: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again