Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 159 (07 Oct 2020)
Sequence version 1 (01 Dec 2001)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

NEDD8-conjugating enzyme UBE2F

Gene

UBE2F

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Accepts the ubiquitin-like protein NEDD8 from the UBA3-NAE1 E1 complex and catalyzes its covalent attachment to other proteins. The specific interaction with the E3 ubiquitin ligase RBX2, but not RBX1, suggests that the RBX2-UBE2F complex neddylates specific target proteins, such as CUL5.1 Publication

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section describes the metabolic pathway(s) associated with a protein.<p><a href='/help/pathway' target='_top'>More...</a></p>Pathwayi: protein neddylation

This protein is involved in the pathway protein neddylation, which is part of Protein modification.
View all proteins of this organism that are known to be involved in the pathway protein neddylation and in Protein modification.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei116Glycyl thioester intermediatePROSITE-ProRule annotation1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionTransferase
Biological processUbl conjugation pathway
LigandATP-binding, Nucleotide-binding

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...
PathwayCommonsi
Q969M7

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-8951664, Neddylation
R-HSA-983168, Antigen processing: Ubiquitination & Proteasome degradation

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...
SignaLinki
Q969M7

SIGNOR Signaling Network Open Resource

More...
SIGNORi
Q969M7

UniPathway: a resource for the exploration and annotation of metabolic pathways

More...
UniPathwayi
UPA00885

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
NEDD8-conjugating enzyme UBE2F (EC:2.3.2.321 Publication)
Alternative name(s):
NEDD8 carrier protein UBE2F
NEDD8 protein ligase UBE2F
NEDD8-conjugating enzyme 2
RING-type E3 NEDD8 transferase UBE2F
Ubiquitin-conjugating enzyme E2 F
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:UBE2F
Synonyms:NCE2
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 2

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000184182.18

Human Gene Nomenclature Database

More...
HGNCi
HGNC:12480, UBE2F

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
617700, gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q969M7

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
140739

Open Targets

More...
OpenTargetsi
ENSG00000184182

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA37130

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q969M7, Tbio

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
UBE2F

Domain mapping of disease mutations (DMDM)

More...
DMDMi
74751725

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002630771 – 185NEDD8-conjugating enzyme UBE2FAdd BLAST185

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei1N-acetylmethionine1 Publication1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

The acetylation of Met-1 increases affinity for DCUN1D3 by about 2 orders of magnitude and is crucial for NEDD8 transfer to cullins.1 Publication

Keywords - PTMi

Acetylation

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q969M7

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q969M7

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q969M7

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q969M7

PeptideAtlas

More...
PeptideAtlasi
Q969M7

PRoteomics IDEntifications database

More...
PRIDEi
Q969M7

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
46263
75795 [Q969M7-1]
75796 [Q969M7-2]
75797 [Q969M7-3]
75798 [Q969M7-4]
75799 [Q969M7-5]
8148

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q969M7

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q969M7

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Widely expressed (at protein level).1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000184182, Expressed in epithelial cell of pancreas and 216 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q969M7, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q969M7, HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000184182, Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with UBA3 and RBX2.

2 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
126682, 17 interactors

The Eukaryotic Linear Motif resource for Functional Sites in Proteins

More...
ELMi
Q969M7

Protein interaction database and analysis system

More...
IntActi
Q969M7, 8 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000478474

Chemistry databases

BindingDB database of measured binding affinities

More...
BindingDBi
Q969M7

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q969M7, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1185
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q969M7

Database of comparative protein structure models

More...
ModBasei
Search...

Protein Data Bank in Europe - Knowledge Base

More...
PDBe-KBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
Q969M7

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini32 – 185UBC corePROSITE-ProRule annotationAdd BLAST154

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni1 – 29Interaction with UBA31 PublicationAdd BLAST29

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the ubiquitin-conjugating enzyme family. UBE2F subfamily.PROSITE-ProRule annotation

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG0420, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000154349

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q969M7

KEGG Orthology (KO)

More...
KOi
K10687

Identification of Orthologs from Complete Genome Data

More...
OMAi
YNMAPPK

Database of Orthologous Groups

More...
OrthoDBi
1302735at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q969M7

TreeFam database of animal gene trees

More...
TreeFami
TF101125

Family and domain databases

Conserved Domains Database

More...
CDDi
cd00195, UBCc, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
3.10.110.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR000608, UBQ-conjugat_E2
IPR023313, UBQ-conjugating_AS
IPR016135, UBQ-conjugating_enzyme/RWD

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00179, UQ_con, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF54495, SSF54495, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00183, UBC_1, 1 hit
PS50127, UBC_2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (7+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 7 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 7 described isoforms and 14 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q969M7-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MLTLASKLKR DDGLKGSRTA ATASDSTRRV SVRDKLLVKE VAELEANLPC
60 70 80 90 100
TCKVHFPDPN KLHCFQLTVT PDEGYYQGGK FQFETEVPDA YNMVPPKVKC
110 120 130 140 150
LTKIWHPNIT ETGEICLSLL REHSIDGTGW APTRTLKDVV WGLNSLFTDL
160 170 180
LNFDDPLNIE AAEHHLRDKE DFRNKVDDYI KRYAR
Length:185
Mass (Da):21,077
Last modified:December 1, 2001 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iB22C86238D13216E
GO
Isoform 2 (identifier: Q969M7-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     170-185: EDFRNKVDDYIKRYAR → SPMLLLHRRTSGIKWMTTSNVMPDNKRGRLQAHGLCYSLSLT

Show »
Length:211
Mass (Da):23,760
Checksum:i26D6D083CACA07ED
GO
Isoform 3 (identifier: Q969M7-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     40-71: Missing.

Show »
Length:153
Mass (Da):17,500
Checksum:i738B62CEF923150C
GO
Isoform 4 (identifier: Q969M7-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     118-120: SLL → RIF
     121-185: Missing.

Show »
Length:120
Mass (Da):13,513
Checksum:iB7A58924FDDB46AF
GO
Isoform 5 (identifier: Q969M7-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     72-185: DEGYYQGGKF...VDDYIKRYAR → ASQSEMPDQDLAPQHHRDRGNMSEFIERTFN

Show »
Length:102
Mass (Da):11,450
Checksum:i676F8ABBE02435AE
GO
Isoform 6 (identifier: Q969M7-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     149-169: Missing.

Show »
Length:164
Mass (Da):18,619
Checksum:iF8EDC983E452DE4D
GO
Isoform 7 (identifier: Q969M7-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-39: MLTLASKLKRDDGLKGSRTAATASDSTRRVSVRDKLLVK → MVLGAGPASPVSGSP

Show »
Length:161
Mass (Da):18,158
Checksum:i44700812DFACB9CE
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 14 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
C9JF62C9JF62_HUMAN
NEDD8-conjugating enzyme UBE2F
UBE2F
139Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9IZ93C9IZ93_HUMAN
NEDD8-conjugating enzyme UBE2F
UBE2F
163Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9JSK8C9JSK8_HUMAN
NEDD8-conjugating enzyme UBE2F
UBE2F
153Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9J9P8C9J9P8_HUMAN
NEDD8-conjugating enzyme UBE2F
UBE2F
171Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9JFD2C9JFD2_HUMAN
NEDD8-conjugating enzyme UBE2F
UBE2F
142Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8WCT3F8WCT3_HUMAN
NEDD8-conjugating enzyme UBE2F
UBE2F
78Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H3BUI7H3BUI7_HUMAN
UBE2F-SCLY readthrough (NMD candida...
UBE2F-SCLY UBE2F, hCG_2039446
73Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H3BSR4H3BSR4_HUMAN
UBE2F-SCLY readthrough (NMD candida...
UBE2F-SCLY UBE2F, hCG_2039446
131Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8WDQ9F8WDQ9_HUMAN
NEDD8-conjugating enzyme UBE2F
UBE2F
101Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8WB39F8WB39_HUMAN
NEDD8-conjugating enzyme UBE2F
UBE2F
86Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
There are more potential isoformsShow all

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti181K → E in BAF82752 (PubMed:14702039).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0557491 – 39MLTLA…KLLVK → MVLGAGPASPVSGSP in isoform 7. CuratedAdd BLAST39
Alternative sequenceiVSP_03727040 – 71Missing in isoform 3. 1 PublicationAdd BLAST32
Alternative sequenceiVSP_03727172 – 185DEGYY…KRYAR → ASQSEMPDQDLAPQHHRDRG NMSEFIERTFN in isoform 5. 1 PublicationAdd BLAST114
Alternative sequenceiVSP_037272118 – 120SLL → RIF in isoform 4. 1 Publication3
Alternative sequenceiVSP_037273121 – 185Missing in isoform 4. 1 PublicationAdd BLAST65
Alternative sequenceiVSP_055750149 – 169Missing in isoform 6. CuratedAdd BLAST21
Alternative sequenceiVSP_037274170 – 185EDFRN…KRYAR → SPMLLLHRRTSGIKWMTTSN VMPDNKRGRLQAHGLCYSLS LT in isoform 2. 1 PublicationAdd BLAST16

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF310723 mRNA Translation: AAL26792.1
AK290063 mRNA Translation: BAF82752.1
AK293334 mRNA Translation: BAG56850.1
AK294107 mRNA Translation: BAG57442.1
AK297502 mRNA Translation: BAG59915.1
AK303094 mRNA Translation: BAG64204.1
AC016776 Genomic DNA Translation: AAY24220.1
CH471063 Genomic DNA Translation: EAW71129.1
CH471063 Genomic DNA Translation: EAW71132.1
BC010549 mRNA Translation: AAH10549.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS2523.1 [Q969M7-1]
CCDS63175.1 [Q969M7-7]
CCDS63176.1 [Q969M7-6]
CCDS63177.1 [Q969M7-3]

NCBI Reference Sequences

More...
RefSeqi
NP_001265234.1, NM_001278305.1 [Q969M7-1]
NP_001265235.1, NM_001278306.1 [Q969M7-7]
NP_001265236.1, NM_001278307.1 [Q969M7-3]
NP_001265237.1, NM_001278308.1 [Q969M7-6]
NP_542409.1, NM_080678.2 [Q969M7-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000272930; ENSP00000272930; ENSG00000184182 [Q969M7-1]
ENST00000409633; ENSP00000387299; ENSG00000184182 [Q969M7-6]
ENST00000409953; ENSP00000386680; ENSG00000184182 [Q969M7-7]
ENST00000414443; ENSP00000399183; ENSG00000184182 [Q969M7-3]
ENST00000433241; ENSP00000393515; ENSG00000184182 [Q969M7-4]
ENST00000441728; ENSP00000409749; ENSG00000184182 [Q969M7-5]
ENST00000612130; ENSP00000478474; ENSG00000184182 [Q969M7-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
140739

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:140739

UCSC genome browser

More...
UCSCi
uc002vxk.4, human [Q969M7-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF310723 mRNA Translation: AAL26792.1
AK290063 mRNA Translation: BAF82752.1
AK293334 mRNA Translation: BAG56850.1
AK294107 mRNA Translation: BAG57442.1
AK297502 mRNA Translation: BAG59915.1
AK303094 mRNA Translation: BAG64204.1
AC016776 Genomic DNA Translation: AAY24220.1
CH471063 Genomic DNA Translation: EAW71129.1
CH471063 Genomic DNA Translation: EAW71132.1
BC010549 mRNA Translation: AAH10549.1
CCDSiCCDS2523.1 [Q969M7-1]
CCDS63175.1 [Q969M7-7]
CCDS63176.1 [Q969M7-6]
CCDS63177.1 [Q969M7-3]
RefSeqiNP_001265234.1, NM_001278305.1 [Q969M7-1]
NP_001265235.1, NM_001278306.1 [Q969M7-7]
NP_001265236.1, NM_001278307.1 [Q969M7-3]
NP_001265237.1, NM_001278308.1 [Q969M7-6]
NP_542409.1, NM_080678.2 [Q969M7-1]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2EDINMR-A26-185[»]
3FN1X-ray2.50B21-185[»]
4GBAX-ray2.40F/G1-25[»]
SMRiQ969M7
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGRIDi126682, 17 interactors
ELMiQ969M7
IntActiQ969M7, 8 interactors
STRINGi9606.ENSP00000478474

Chemistry databases

BindingDBiQ969M7

PTM databases

iPTMnetiQ969M7
PhosphoSitePlusiQ969M7

Polymorphism and mutation databases

BioMutaiUBE2F
DMDMi74751725

Proteomic databases

jPOSTiQ969M7
MassIVEiQ969M7
MaxQBiQ969M7
PaxDbiQ969M7
PeptideAtlasiQ969M7
PRIDEiQ969M7
ProteomicsDBi46263
75795 [Q969M7-1]
75796 [Q969M7-2]
75797 [Q969M7-3]
75798 [Q969M7-4]
75799 [Q969M7-5]
8148

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
34487, 214 antibodies

The DNASU plasmid repository

More...
DNASUi
140739

Genome annotation databases

EnsembliENST00000272930; ENSP00000272930; ENSG00000184182 [Q969M7-1]
ENST00000409633; ENSP00000387299; ENSG00000184182 [Q969M7-6]
ENST00000409953; ENSP00000386680; ENSG00000184182 [Q969M7-7]
ENST00000414443; ENSP00000399183; ENSG00000184182 [Q969M7-3]
ENST00000433241; ENSP00000393515; ENSG00000184182 [Q969M7-4]
ENST00000441728; ENSP00000409749; ENSG00000184182 [Q969M7-5]
ENST00000612130; ENSP00000478474; ENSG00000184182 [Q969M7-1]
GeneIDi140739
KEGGihsa:140739
UCSCiuc002vxk.4, human [Q969M7-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
140739
DisGeNETi140739
EuPathDBiHostDB:ENSG00000184182.18

GeneCards: human genes, protein and diseases

More...
GeneCardsi
UBE2F
HGNCiHGNC:12480, UBE2F
HPAiENSG00000184182, Low tissue specificity
MIMi617700, gene
neXtProtiNX_Q969M7
OpenTargetsiENSG00000184182
PharmGKBiPA37130

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG0420, Eukaryota
GeneTreeiENSGT00940000154349
InParanoidiQ969M7
KOiK10687
OMAiYNMAPPK
OrthoDBi1302735at2759
PhylomeDBiQ969M7
TreeFamiTF101125

Enzyme and pathway databases

UniPathwayiUPA00885
PathwayCommonsiQ969M7
ReactomeiR-HSA-8951664, Neddylation
R-HSA-983168, Antigen processing: Ubiquitination & Proteasome degradation
SignaLinkiQ969M7
SIGNORiQ969M7

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
140739, 29 hits in 875 CRISPR screens
EvolutionaryTraceiQ969M7

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
140739
PharosiQ969M7, Tbio

Protein Ontology

More...
PROi
PR:Q969M7
RNActiQ969M7, protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000184182, Expressed in epithelial cell of pancreas and 216 other tissues
ExpressionAtlasiQ969M7, baseline and differential
GenevisibleiQ969M7, HS

Family and domain databases

CDDicd00195, UBCc, 1 hit
Gene3Di3.10.110.10, 1 hit
InterProiView protein in InterPro
IPR000608, UBQ-conjugat_E2
IPR023313, UBQ-conjugating_AS
IPR016135, UBQ-conjugating_enzyme/RWD
PfamiView protein in Pfam
PF00179, UQ_con, 1 hit
SUPFAMiSSF54495, SSF54495, 1 hit
PROSITEiView protein in PROSITE
PS00183, UBC_1, 1 hit
PS50127, UBC_2, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiUBE2F_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q969M7
Secondary accession number(s): A8K1Z8
, B4DDT9, B4DFI1, B4DMK3, B4DZU2, B8ZZG2, C9J212, H9KVB9
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: December 12, 2006
Last sequence update: December 1, 2001
Last modified: October 7, 2020
This is version 159 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Reference proteome

Documents

  1. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  2. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  4. SIMILARITY comments
    Index of protein domains and families
  5. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again