Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - Q969K4 (ABTB1_HUMAN)

Entry version 151 (02 Dec 2020)
Sequence version 1 (01 Dec 2001)
Previous versions | rss
Add a publicationFeedback
Protein

Ankyrin repeat and BTB/POZ domain-containing protein 1

Gene

ABTB1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

May act as a mediator of the PTEN growth-suppressive signaling pathway. May play a role in developmental processes.2 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionElongation factor
Biological processProtein biosynthesis

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		Q969K4

SIGNOR Signaling Network Open Resource

More...SIGNORi		Q969K4

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Ankyrin repeat and BTB/POZ domain-containing protein 1
Alternative name(s):
Elongation factor 1A-binding protein
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:ABTB1Imported
Synonyms:BPOZ1 Publication
ORF Names:PP2259
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 3

Organism-specific databases

Eukaryotic Pathogen and Host Database Resources

More...EuPathDBi		HostDB:ENSG00000114626.17

Human Gene Nomenclature Database

More...HGNCi		HGNC:18275, ABTB1

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		608308, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_Q969K4

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...DisGeNETi		80325

Open Targets

More...OpenTargetsi		ENSG00000114626

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA24418

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		Q969K4, Tbio

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		ABTB1

Domain mapping of disease mutations (DMDM)

More...DMDMi		74751721

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002482671 – 478Ankyrin repeat and BTB/POZ domain-containing protein 1Add BLAST478

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		Q969K4

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		Q969K4

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q969K4

PeptideAtlas

More...PeptideAtlasi		Q969K4

PRoteomics IDEntifications database

More...PRIDEi		Q969K4

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		75781 [Q969K4-1]
75782 [Q969K4-2]
75783 [Q969K4-3]
75784 [Q969K4-4]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q969K4

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q969K4

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Ubiquitously expressed in all fetal tissues examined including heart, brain, liver, and kidney. Also expressed at lower levels in both adult heart and hypertrophic heart.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000114626, Expressed in prostate gland and 203 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		Q969K4, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q969K4, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000114626, Tissue enhanced (blood)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		123237, 12 interactors

Protein interaction database and analysis system

More...IntActi		Q969K4, 10 interactors

Molecular INTeraction database

More...MINTi		Q969K4

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000232744

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		Q969K4, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		Q969K4

Database of comparative protein structure models

More...ModBasei		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati1 – 31ANK 1Sequence analysisAdd BLAST31
Repeati35 – 64ANK 2Sequence analysisAdd BLAST30
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini115 – 182BTB 1PROSITE-ProRule annotationAdd BLAST68
Domaini272 – 346BTB 2PROSITE-ProRule annotationAdd BLAST75

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and domains' section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili451 – 477Sequence analysisAdd BLAST27

Keywords - Domaini

ANK repeat, Coiled coil, Repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG0511, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00390000017131

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_022885_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q969K4

Identification of Orthologs from Complete Genome Data

More...OMAi		LCGHYEL

Database of Orthologous Groups

More...OrthoDBi		871743at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q969K4

TreeFam database of animal gene trees

More...TreeFami		TF329194

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		1.25.40.20, 1 hit

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR002110, Ankyrin_rpt
IPR020683, Ankyrin_rpt-contain_dom
IPR036770, Ankyrin_rpt-contain_sf
IPR000210, BTB/POZ_dom
IPR011333, SKP1/BTB/POZ_sf

Pfam protein domain database

More...Pfami		View protein in Pfam
PF12796, Ank_2, 1 hit
PF00651, BTB, 2 hits

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00248, ANK, 2 hits
SM00225, BTB, 2 hits

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF48403, SSF48403, 1 hit
SSF54695, SSF54695, 2 hits

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS50297, ANK_REP_REGION, 1 hit
PS50088, ANK_REPEAT, 1 hit
PS50097, BTB, 2 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 22 Publications (identifier: Q969K4-1) [UniParc]FASTAAdd to basket
Also known as: BPOZ-21 Publication

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MDTSDLFASC RKGDVGRVRY LLEQRDVEVN VRDKWDSTPL YYACLCGHEE 
        60         70         80         90        100
LVLYLLANGA RCEANTFDGE RCLYGALSDP IRRALRDYKQ VTASCRRRDY 
       110        120        130        140        150
YDDFLQRLLE QGIHSDVVFV VHGKPFRVHR CVLGARSAYF ANMLDTKWKG 
       160        170        180        190        200
KSVVVLRHPL INPVAFGALL QYLYTGRLDI GVEHVSDCER LAKQCQLWDL 
       210        220        230        240        250
LSDLEAKCEK VSEFVASKPG TCVKVLTIEP PPADPRLRED MALLADCALP 
       260        270        280        290        300
PELRGDLWEL PFPCPDGFNS CPDICFRVAG CSFLCHKAFF CGRSDYFRAL 
       310        320        330        340        350
LDDHFRESEE PATSGGPPAV TLHGISPDVF THVLYYMYSD HTELSPEAAY 
       360        370        380        390        400
DVLSVADMYL LPGLKRLCGR SLAQMLDEDT VVGVWRVAKL FRLARLEDQC 
       410        420        430        440        450
TEYMAKVIEK LVEREDFVEA VKEEAAAVAA RQETDSIPLV DDIRFHVAST 
       460        470 
VQTYSAIEEA QQRLRALEDL LVSIGLDC
Length:478
Mass (Da):53,979
Last modified:December 1, 2001 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iBF2B9959A5BF0BB5
GO
Isoform 11 Publication (identifier: Q969K4-2) [UniParc]FASTAAdd to basket
Also known as: BPOZ-11 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     1-142: Missing.

Show »
Length:336
Mass (Da):37,576
Checksum:i71B2545E5F3EB18A
GO
Isoform 31 Publication (identifier: Q969K4-3) [UniParc]FASTAAdd to basket
Also known as: BPOZ-31 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     1-40: MDTSDLFASCRKGDVGRVRYLLEQRDVEVNVRDKWDSTPL → MWAECGTCWSSETWR

Show »
Length:453
Mass (Da):51,141
Checksum:i5EE45A2DA214325F
GO
Isoform 41 Publication (identifier: Q969K4-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     24-50: Missing.
     87-196: DYKQVTASCR...DCERLAKQCQ → LCGHEE
     255-287: Missing.
     468-478: EDLLVSIGLDC → LETSMCMRLC...SPKSSPLALA

Show »
Length:405
Mass (Da):44,428
Checksum:iF85371BD5B10F7D8
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H7C4W8H7C4W8_HUMAN
Ankyrin repeat and BTB/POZ domain-c...
ABTB1
141Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F2Z3F5F2Z3F5_HUMAN
Ankyrin repeat and BTB/POZ domain-c...
ABTB1
57Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAQ04661 differs from that shown. Reason: Frameshift.Curated

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0521481 – 142Missing in isoform 1. 2 PublicationsAdd BLAST142
Alternative sequenceiVSP_0521491 – 40MDTSD…DSTPL → MWAECGTCWSSETWR in isoform 3. 1 PublicationAdd BLAST40
Alternative sequenceiVSP_05215024 – 50Missing in isoform 4. 1 PublicationAdd BLAST27
Alternative sequenceiVSP_05215187 – 196DYKQV…AKQCQ → LCGHEE in isoform 4. 1 PublicationAdd BLAST110
Alternative sequenceiVSP_052152255 – 287Missing in isoform 4. 1 PublicationAdd BLAST33
Alternative sequenceiVSP_052153468 – 478EDLLVSIGLDC → LETSMCMRLCAALLPAPCTL RASWGVRGAQWGFSSLHEPG DPRGGSIWDEPPPPNAQASP QDPGGGHHSGKPGVGVGFGL STFLLQIPPTHPSPKSSPLA LA in isoform 4. 1 PublicationAdd BLAST11

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AB053324 mRNA Translation: BAB55648.1
AB053325 mRNA Translation: BAB55649.1
AB053326 mRNA Translation: BAB55650.1
AF447886 mRNA Translation: AAQ04661.1 Frameshift.
AK130594 mRNA Translation: BAC85392.1
CH471052 Genomic DNA Translation: EAW79333.1
CH471052 Genomic DNA Translation: EAW79334.1
BC011858 mRNA Translation: AAH11858.1
AF297986 mRNA Translation: AAK57478.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS3045.1 [Q969K4-1]
CCDS46901.1 [Q969K4-2]

Protein sequence database of the Protein Information Resource

More...PIRi		JC7326

NCBI Reference Sequences

More...RefSeqi		NP_115937.1, NM_032548.3 [Q969K4-2]
NP_742024.1, NM_172027.2 [Q969K4-1]
XP_011511515.1, XM_011513213.1 [Q969K4-2]
XP_016862776.1, XM_017007287.1 [Q969K4-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000232744; ENSP00000232744; ENSG00000114626 [Q969K4-1]
ENST00000453791; ENSP00000412684; ENSG00000114626 [Q969K4-2]
ENST00000468137; ENSP00000417366; ENSG00000114626 [Q969K4-2]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		80325

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:80325

UCSC genome browser

More...UCSCi		uc003ejr.4, human [Q969K4-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB053324 mRNA Translation: BAB55648.1
AB053325 mRNA Translation: BAB55649.1
AB053326 mRNA Translation: BAB55650.1
AF447886 mRNA Translation: AAQ04661.1 Frameshift.
AK130594 mRNA Translation: BAC85392.1
CH471052 Genomic DNA Translation: EAW79333.1
CH471052 Genomic DNA Translation: EAW79334.1
BC011858 mRNA Translation: AAH11858.1
AF297986 mRNA Translation: AAK57478.1
CCDSiCCDS3045.1 [Q969K4-1]
CCDS46901.1 [Q969K4-2]
PIRiJC7326
RefSeqiNP_115937.1, NM_032548.3 [Q969K4-2]
NP_742024.1, NM_172027.2 [Q969K4-1]
XP_011511515.1, XM_011513213.1 [Q969K4-2]
XP_016862776.1, XM_017007287.1 [Q969K4-2]

3D structure databases

SMRiQ969K4
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi123237, 12 interactors
IntActiQ969K4, 10 interactors
MINTiQ969K4
STRINGi9606.ENSP00000232744

PTM databases

iPTMnetiQ969K4
PhosphoSitePlusiQ969K4

Polymorphism and mutation databases

BioMutaiABTB1
DMDMi74751721

Proteomic databases

jPOSTiQ969K4
MassIVEiQ969K4
PaxDbiQ969K4
PeptideAtlasiQ969K4
PRIDEiQ969K4
ProteomicsDBi75781 [Q969K4-1]
75782 [Q969K4-2]
75783 [Q969K4-3]
75784 [Q969K4-4]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		33153, 237 antibodies

Genome annotation databases

EnsembliENST00000232744; ENSP00000232744; ENSG00000114626 [Q969K4-1]
ENST00000453791; ENSP00000412684; ENSG00000114626 [Q969K4-2]
ENST00000468137; ENSP00000417366; ENSG00000114626 [Q969K4-2]
GeneIDi80325
KEGGihsa:80325
UCSCiuc003ejr.4, human [Q969K4-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		80325
DisGeNETi80325
EuPathDBiHostDB:ENSG00000114626.17

GeneCards: human genes, protein and diseases

More...GeneCardsi		ABTB1
HGNCiHGNC:18275, ABTB1
HPAiENSG00000114626, Tissue enhanced (blood)
MIMi608308, gene
neXtProtiNX_Q969K4
OpenTargetsiENSG00000114626
PharmGKBiPA24418

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG0511, Eukaryota
GeneTreeiENSGT00390000017131
HOGENOMiCLU_022885_0_0_1
InParanoidiQ969K4
OMAiLCGHYEL
OrthoDBi871743at2759
PhylomeDBiQ969K4
TreeFamiTF329194

Enzyme and pathway databases

PathwayCommonsiQ969K4
SIGNORiQ969K4

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		80325, 3 hits in 847 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		ABTB1, human

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		ABTB1

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		80325
PharosiQ969K4, Tbio

Protein Ontology

More...PROi		PR:Q969K4
RNActiQ969K4, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000114626, Expressed in prostate gland and 203 other tissues
ExpressionAtlasiQ969K4, baseline and differential
GenevisibleiQ969K4, HS

Family and domain databases

Gene3Di1.25.40.20, 1 hit
InterProiView protein in InterPro
IPR002110, Ankyrin_rpt
IPR020683, Ankyrin_rpt-contain_dom
IPR036770, Ankyrin_rpt-contain_sf
IPR000210, BTB/POZ_dom
IPR011333, SKP1/BTB/POZ_sf
PfamiView protein in Pfam
PF12796, Ank_2, 1 hit
PF00651, BTB, 2 hits
SMARTiView protein in SMART
SM00248, ANK, 2 hits
SM00225, BTB, 2 hits
SUPFAMiSSF48403, SSF48403, 1 hit
SSF54695, SSF54695, 2 hits
PROSITEiView protein in PROSITE
PS50297, ANK_REP_REGION, 1 hit
PS50088, ANK_REPEAT, 1 hit
PS50097, BTB, 2 hits

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiABTB1_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q969K4
Secondary accession number(s): D3DNB0
, Q6ZNU9, Q71MF1, Q96S62, Q96S63
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: September 5, 2006
Last sequence update: December 1, 2001
Last modified: December 2, 2020
This is version 151 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again