UniProtKB - Q969E1 (LEAP2_HUMAN)

BLAST

>sp|Q969E1|LEAP2_HUMAN Liver-expressed antimicrobial peptide 2 OS=Homo sapiens OX=9606 GN=LEAP2 PE=1 SV=1
MWHLKLCAVLMIFLLLLGQIDGSPIPEVSSAKRRPRRMTPFWRGVSLRPIGASCRDDSEC
ITRLCRKRRCSLSVAQE

Align
Format
Add to basket Added to basket
History
Entry version 113 (12 Sep 2018)
Sequence version 1 (01 Dec 2001)
Previous versions | rss
Other tutorials and videos
Help video
Feedback

Protein

Liver-expressed antimicrobial peptide 2

Gene

LEAP2

Organism

Homo sapiens (Human)

Status

Reviewed-Annotation score: -Experimental evidence at protein levelⁱ

Functionⁱ

Has an antimicrobial activity.1 Publication

GO - Biological processⁱ

antimicrobial humoral immune response mediated by antimicrobial peptide
Source: UniProtKB
Inferred from mutant phenotypeⁱ
- 12493837
antimicrobial humoral response Source: Reactome
defense response to bacterium Source: UniProtKB-KW
defense response to fungus
Source: UniProtKB
Inferred from mutant phenotypeⁱ
- 12493837

View the complete GO annotation on QuickGO ...

Keywordsⁱ

Molecular function	Antibiotic, Antimicrobial

Molecular function

Antibiotic, Antimicrobial

Enzyme and pathway databases

Reactomeⁱ	R-HSA-6803157 Antimicrobial peptides

Reactomeⁱ

R-HSA-6803157 Antimicrobial peptides

Names & Taxonomyⁱ

Protein namesⁱ	Recommended name: Liver-expressed antimicrobial peptide 2 Short name: LEAP-2
Gene namesⁱ	Name:LEAP2
Organismⁱ	Homo sapiens (Human)
Taxonomic identifierⁱ	9606 [NCBI]
Taxonomic lineageⁱ	cellular organisms › Eukaryota › Opisthokonta › Metazoa › Eumetazoa › Bilateria › Deuterostomia › Chordata › Craniata › Vertebrata › Gnathostomata › Teleostomi › Euteleostomi › Sarcopterygii › Dipnotetrapodomorpha › Tetrapoda › Amniota › Mammalia › Theria › Eutheria › Boreoeutheria › Euarchontoglires › Primates › Haplorrhini › Simiiformes › Catarrhini › Hominoidea › Hominidae › Homininae › Homo
Proteomesⁱ	UP000005640 Componentⁱ: Chromosome 5

Organism-specific databases

EuPathDBⁱ	HostDB:ENSG00000164406.7
Human Gene Nomenclature Database More...HGNCⁱ	HGNC:29571 LEAP2
MIMⁱ	611373 gene
neXtProtⁱ	NX_Q969E1

Keywords - Cellular componentⁱ

Secreted

Pathology & Biotechⁱ

Organism-specific databases

DisGeNET More...DisGeNETⁱ	116842
Open Targets More...OpenTargetsⁱ	ENSG00000164406
PharmGKBⁱ	PA162393840

Polymorphism and mutation databases

BioMutaⁱ	LEAP2
DMDMⁱ	20138667

PTM / Processingⁱ

Molecule processing

Feature key	Position(s)	DescriptionActions	Length
Signal peptideⁱ	1 – 22	Sequence analysisAdd BLAST	22
PropeptideⁱPRO_0000017355	23 – 37	Add BLAST	15
ChainⁱPRO_0000017356	38 – 77	Liver-expressed antimicrobial peptide 2Add BLAST	40

Amino acid modifications

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Disulfide bondⁱ	54 ↔ 65
Disulfide bondⁱ	60 ↔ 70

Keywords - PTMⁱ

Cleavage on pair of basic residues, Disulfide bond

Proteomic databases

PaxDbⁱ	Q969E1
PeptideAtlas More...PeptideAtlasⁱ	Q969E1
PRIDEⁱ	Q969E1
ProteomicsDBⁱ	75739

PTM databases

iPTMnetⁱ	Q969E1
PhosphoSitePlusⁱ	Q969E1

Expressionⁱ

Gene expression databases

Bgeeⁱ	ENSG00000164406 Expressed in 167 organ(s), highest expression level in liver
CleanExⁱ	HS_LEAP2
Genevisibleⁱ	Q969E1 HS

Interactionⁱ

Protein-protein interaction databases

BioGridⁱ	125535, 5 interactors

BioGridⁱ

125535, 5 interactors

Structureⁱ

Secondary structure

Legend: HelixTurnBeta strandPDB Structure known for this area

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Beta strandⁱ	46 – 48	Combined sources		3
Helixⁱ	57 – 59	Combined sources		3

Show more details

3D structure databases

ProteinModelPortalⁱ	Q969E1
SMRⁱ	Q969E1
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Miscellaneous databases

EvolutionaryTraceⁱ

Q969E1

Family & Domainsⁱ

Sequence similaritiesⁱ

Belongs to the LEAP2 family.Curated

Keywords - Domainⁱ

Signal

Phylogenomic databases

eggNOGⁱ	ENOG410J7PZ Eukaryota ENOG410Y6EA LUCA
Ensembl GeneTree More...GeneTreeⁱ	ENSGT00390000013467
HOGENOMⁱ	HOG000037938
HOVERGENⁱ	HBG052319
InParanoidⁱ	Q969E1
OMAⁱ	TMLRSME
Database of Orthologous Groups More...OrthoDBⁱ	EOG091G13A9
PhylomeDBⁱ	Q969E1
TreeFamⁱ	TF336274

Family and domain databases

InterProⁱ	View protein in InterPro IPR009955 LEAP-2
PANTHERⁱ	PTHR21007 PTHR21007, 1 hit
Pfam protein domain database More...Pfamⁱ	View protein in Pfam PF07359 LEAP-2, 1 hit

Sequenceⁱ

Sequence statusⁱ: Complete.

Sequence processingⁱ: The displayed sequence is further processed into a mature form.

Q969E1-1 [UniParc]FASTA Add to basket

« Hide

        10         20         30         40         50
MWHLKLCAVL MIFLLLLGQI DGSPIPEVSS AKRRPRRMTP FWRGVSLRPI 
        60         70 
GASCRDDSEC ITRLCRKRRC SLSVAQE

Length:77

Mass (Da):8,814

Last modified:December 1, 2001 - v1

Checksum:ⁱFD1C300B0F42E4C9

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	AJ306405 mRNA Translation: CAC51306.1 AJ409064 Genomic DNA Translation: CAC51515.1 AJ409065 mRNA Translation: CAC51516.1 CH471062 Genomic DNA Translation: EAW62306.1 CH471062 Genomic DNA Translation: EAW62307.1 BC070199 mRNA Translation: AAH70199.1
The Consensus CDS (CCDS) project More...CCDSⁱ	CCDS4163.1
NCBI Reference Sequences More...RefSeqⁱ	NP_443203.1, NM_052971.2
UniGeneⁱ	Hs.337588

Genome annotation databases

Ensemblⁱ	ENST00000296877; ENSP00000296877; ENSG00000164406
GeneIDⁱ	116842
KEGGⁱ	hsa:116842
UCSC genome browser More...UCSCⁱ	uc003kyc.4 human

Similar proteinsⁱ

100% Identity
90% Identity
50% Identity

Protein	Similar proteins		Species	Score	Length	Source
Q969E1	LEAP2 isoform 1		PANTR		77	UniRef100_Q969E1
LEAP2 isoform 1		PONAB		77
Uncharacterized protein		CERAT		77
Uncharacterized protein		PANPA		77
Uncharacterized protein		MANLE		77
+2

Protein	Similar proteins		Species	Score	Length	Source
Q969E1	Liver-expressed antimicrobial peptide 2		MACMU		77	UniRef90_Q969E1
LEAP2 isoform 1		PANTR		77
LEAP2 isoform 1		PONAB		77
Uncharacterized protein		CERAT		77
Uncharacterized protein		PANPA		77
+16

Protein	Similar proteins		Species	Score	Length	Source
Q969E1	Liver-expressed antimicrobial peptide 2		MACMU		77	UniRef50_Q969E1
Liver-expressed antimicrobial peptide 2 (Fragment)		CAVPO		71
LEAP2 isoform 1		PANTR		77
LEAP2 isoform 1		PONAB		77
Uncharacterized protein		CERAT		77
+52

Cross-referencesⁱ

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	AJ306405 mRNA Translation: CAC51306.1 AJ409064 Genomic DNA Translation: CAC51515.1 AJ409065 mRNA Translation: CAC51516.1 CH471062 Genomic DNA Translation: EAW62306.1 CH471062 Genomic DNA Translation: EAW62307.1 BC070199 mRNA Translation: AAH70199.1
CCDSⁱ	CCDS4163.1
RefSeqⁱ	NP_443203.1, NM_052971.2
UniGeneⁱ	Hs.337588

3D structure databases

Select the link destinations: Protein Data Bank Europe More...PDBeⁱ Protein Data Bank RCSB More...RCSB PDBⁱ Protein Data Bank Japan More...PDBjⁱ Links Updated	PDB entry	Method	Resolution (Å)	Chain	Positions	PDBsum
	2L1Q	NMR	-	A	38-77	[»]
ProteinModelPortalⁱ	Q969E1
SMRⁱ	Q969E1
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Protein-protein interaction databases

BioGridⁱ	125535, 5 interactors

BioGridⁱ

125535, 5 interactors

PTM databases

iPTMnetⁱ	Q969E1
PhosphoSitePlusⁱ	Q969E1

Polymorphism and mutation databases

BioMutaⁱ	LEAP2
DMDMⁱ	20138667

Proteomic databases

PaxDbⁱ	Q969E1
PeptideAtlasⁱ	Q969E1
PRIDEⁱ	Q969E1
ProteomicsDBⁱ	75739

Protocols and materials databases

Structural Biology Knowledgebase	Search...

Structural Biology Knowledgebase

Search...

Genome annotation databases

Ensemblⁱ	ENST00000296877; ENSP00000296877; ENSG00000164406
GeneIDⁱ	116842
KEGGⁱ	hsa:116842
UCSCⁱ	uc003kyc.4 human

Organism-specific databases

CTDⁱ	116842
DisGeNETⁱ	116842
EuPathDBⁱ	HostDB:ENSG00000164406.7
GeneCardsⁱ	LEAP2
HGNCⁱ	HGNC:29571 LEAP2
MIMⁱ	611373 gene
neXtProtⁱ	NX_Q969E1
OpenTargetsⁱ	ENSG00000164406
PharmGKBⁱ	PA162393840
GenAtlas: human gene database More...GenAtlasⁱ	Search...

Phylogenomic databases

eggNOGⁱ	ENOG410J7PZ Eukaryota ENOG410Y6EA LUCA
GeneTreeⁱ	ENSGT00390000013467
HOGENOMⁱ	HOG000037938
HOVERGENⁱ	HBG052319
InParanoidⁱ	Q969E1
OMAⁱ	TMLRSME
OrthoDBⁱ	EOG091G13A9
PhylomeDBⁱ	Q969E1
TreeFamⁱ	TF336274

Enzyme and pathway databases

Reactomeⁱ	R-HSA-6803157 Antimicrobial peptides

Reactomeⁱ

R-HSA-6803157 Antimicrobial peptides

Miscellaneous databases

EvolutionaryTraceⁱ	Q969E1
GenomeRNAiⁱ	116842
Protein Ontology More...PROⁱ	PR:Q969E1
SOURCEⁱ	Search...

Gene expression databases

Bgeeⁱ	ENSG00000164406 Expressed in 167 organ(s), highest expression level in liver
CleanExⁱ	HS_LEAP2
Genevisibleⁱ	Q969E1 HS

Family and domain databases

InterProⁱ	View protein in InterPro IPR009955 LEAP-2
PANTHERⁱ	PTHR21007 PTHR21007, 1 hit
Pfamⁱ	View protein in Pfam PF07359 LEAP-2, 1 hit
ProtoNetⁱ	Search...

Entry informationⁱ

Entry nameⁱ	LEAP2_HUMAN
Accessionⁱ	Q969E1Primary (citable) accession number: Q969E1 Secondary accession number(s): D3DQ91
Entry historyⁱ	Integrated into UniProtKB/Swiss-Prot:	March 5, 2002
	Last sequence update:	December 1, 2001
	Last modified:	September 12, 2018
	This is version 113 of the entry and version 1 of the sequence. See complete history.
Entry statusⁱ	Reviewed (UniProtKB/Swiss-Prot)
Annotation program	Chordata Protein Annotation Program
Disclaimer	Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousⁱ

Keywords - Technical termⁱ

3D-structure, Complete proteome, Reference proteome

Documents

Human chromosome 5
Human chromosome 5: entries, gene names and cross-references to MIM
SIMILARITY comments
Index of protein domains and families
PDB cross-references
Index of Protein Data Bank (PDB) cross-references
MIM cross-references
Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

UniProtKB

UniParc

Help

UniRef

Proteomes

Annotation systems

Supporting data

UniProtKB - Q969E1 (LEAP2_HUMAN)

Your basket is currently empty. i <p>When browsing through different UniProt proteins, you can use the ‘basket’ to save them, so that you can back to find or analyse them later.<p><a href='/help/basket' target='_top'>More...</a></p>

Liver-expressed antimicrobial peptide 2

LEAP2

Select a section on the left to see content.

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Biological processi

Enzyme and pathway databases

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

Organism-specific databases

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted

Extracellular region or secreted

Keywords - Cellular componenti

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

Polymorphism and mutation databases

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Amino acid modifications

Keywords - PTMi

Proteomic databases

PTM databases

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

3D structure databases

Miscellaneous databases

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Keywords - Domaini

Phylogenomic databases

Family and domain databases

Sequence databases

Genome annotation databases

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

3D structure databases

Protein-protein interaction databases

PTM databases

Polymorphism and mutation databases

Proteomic databases

Protocols and materials databases

Genome annotation databases

Organism-specific databases

Phylogenomic databases

Enzyme and pathway databases

Miscellaneous databases

Gene expression databases

Family and domain databases

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Documents

UniProt is an ELIXIR core data resource

Your basket is currently empty. ⁱ

Functionⁱ

GO - Biological processⁱ

Names & Taxonomyⁱ

Subcellular locationⁱ

Keywords - Cellular componentⁱ

Pathology & Biotechⁱ

PTM / Processingⁱ

Keywords - PTMⁱ

Expressionⁱ

Interactionⁱ

Structureⁱ

Family & Domainsⁱ

Sequence similaritiesⁱ

Keywords - Domainⁱ

Cross-referencesⁱ

Entry informationⁱ

Miscellaneousⁱ

Keywords - Technical termⁱ