Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 128 (02 Jun 2021)
Sequence version 1 (01 Dec 2001)
Previous versions | rss
Add a publicationFeedback
Protein

N-alpha-acetyltransferase 60

Gene

Naa60

Organism
Drosophila melanogaster (Fruit fly)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Displays alpha (N-terminal) acetyltransferase activity towards a range of N-terminal sequences including those starting with Met-Lys, Met-Val, Met-Ala and Met-Met. Required for normal chromosomal segregation during anaphase.

1 Publication

Shows histone acetyltransferase activity toward free histones.

1 Publication

Does not show histone acetyltransferase activity toward free histones.

1 Publication

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the interaction between a single amino acid and another chemical entity. Priority is given to the annotation of physiological ligands.<p><a href='/help/binding' target='_top'>More...</a></p>Binding sitei59SubstrateBy similarity1
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei139By similarity1
Binding sitei141Substrate; via carbonyl oxygenBy similarity1
Active sitei180By similarity1
Binding sitei185Acetyl-CoABy similarity1
Binding sitei207SubstrateBy similarity1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionAcyltransferase, Chromatin regulator, Transferase
Biological processChromosome partition

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
N-alpha-acetyltransferase 60 (EC:2.3.1.259By similarity, EC:2.3.1.481 Publication)
Short name:
dNaa601 Publication
Alternative name(s):
NatF catalytic subunit
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Naa60Imported
ORF Names:CG18177
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiDrosophila melanogaster (Fruit fly)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri7227 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaEcdysozoaArthropodaHexapodaInsectaPterygotaNeopteraEndopterygotaDipteraBrachyceraMuscomorphaEphydroideaDrosophilidaeDrosophilaSophophora
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000803 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 3L

Organism-specific databases

Drosophila genome database

More...
FlyBasei
FBgn0036039, Naa60

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00004133631 – 276N-alpha-acetyltransferase 60Add BLAST276

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q95SX8

PRoteomics IDEntifications database

More...
PRIDEi
Q95SX8

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
FBgn0036039, Expressed in embryo and 39 other tissues

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q95SX8, DM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
64530, 1 interactor

Protein interaction database and analysis system

More...
IntActi
Q95SX8, 2 interactors

STRING: functional protein association networks

More...
STRINGi
7227.FBpp0089006

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q95SX8

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini34 – 239N-acetyltransferasePROSITE-ProRule annotationAdd BLAST206

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni143 – 145Acetyl-CoA bindingBy similarity3
Regioni151 – 156Acetyl-CoA bindingBy similarity6
Regioni192 – 195Acetyl-CoA bindingBy similarity4
Regioni204 – 215Required for homodimerizationBy similarityAdd BLAST12

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG3138, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000008314

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q95SX8

Identification of Orthologs from Complete Genome Data

More...
OMAi
TVKQLCG

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q95SX8

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR016181, Acyl_CoA_acyltransferase
IPR000182, GNAT_dom

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00583, Acetyltransf_1, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF55729, SSF55729, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS51186, GNAT, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform A1 Publication (identifier: Q95SX8-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAQFTLYNKH SAPPSSESTR VDCEHVPLCS INDVQLRFLV PDDLTEVRQL
60 70 80 90 100
CQEWFPIDYP LSWYEDITSS TRFFALAAVY NLAIIGLIVA EIKPYRNVNK
110 120 130 140 150
EVIANMSDSD ELYTRLSGFP MQDKGILPDS MGRSADVGYI LSLGVHRSHR
160 170 180 190 200
RNGIGSLLLD ALMNHLTTAE RHSVKAIFLH TLTTNQPAIF FYEKRRFTLH
210 220 230 240 250
SFLPYYYNIR GKGKDGFTYV NYINGGHPPW TLLDHIKHYA SMVRHTSSLC
260 270
AWLAGRVQQV VRWFYHKLLT RFNFIE
Length:276
Mass (Da):31,869
Last modified:December 1, 2001 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i45958EEBB2C3FFD3
GO
Isoform B1 Publication (identifier: Q95SX8-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     102-122: Missing.

Show »
Length:255
Mass (Da):29,512
Checksum:i7B426F05C7A96DEE
GO
Isoform C1 Publication (identifier: Q95SX8-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     102-122: Missing.
     234-276: DHIKHYASMVRHTSSLCAWLAGRVQQVVRWFYHKLLTRFNFIE → YPFSKYLYALGCIAFLSMISLYFWLPS

Show »
Length:239
Mass (Da):27,461
Checksum:i24E10C5B25881F1C
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_041889102 – 122Missing in isoform B and isoform C. 2 PublicationsAdd BLAST21
Alternative sequenceiVSP_041890234 – 276DHIKH…FNFIE → YPFSKYLYALGCIAFLSMIS LYFWLPS in isoform C. 1 PublicationAdd BLAST43

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AE014296 Genomic DNA Translation: AAF50213.2
AE014296 Genomic DNA Translation: AAS65049.1
AE014296 Genomic DNA Translation: ACL83284.1
AY060437 mRNA Translation: AAL25476.1
BT001491 mRNA Translation: AAN71246.1

NCBI Reference Sequences

More...
RefSeqi
NP_001137929.1, NM_001144457.3 [Q95SX8-3]
NP_648353.3, NM_140096.5 [Q95SX8-2]
NP_996032.1, NM_206310.3 [Q95SX8-1]

Genome annotation databases

Ensembl metazoan genome annotation project

More...
EnsemblMetazoai
FBtr0089410; FBpp0088430; FBgn0036039 [Q95SX8-2]
FBtr0089411; FBpp0089006; FBgn0036039 [Q95SX8-1]
FBtr0114566; FBpp0113058; FBgn0036039 [Q95SX8-3]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
39142

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
dme:Dmel_CG18177

UCSC genome browser

More...
UCSCi
CG18177-RA, d. melanogaster [Q95SX8-1]
CG18177-RB, d. melanogaster

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AE014296 Genomic DNA Translation: AAF50213.2
AE014296 Genomic DNA Translation: AAS65049.1
AE014296 Genomic DNA Translation: ACL83284.1
AY060437 mRNA Translation: AAL25476.1
BT001491 mRNA Translation: AAN71246.1
RefSeqiNP_001137929.1, NM_001144457.3 [Q95SX8-3]
NP_648353.3, NM_140096.5 [Q95SX8-2]
NP_996032.1, NM_206310.3 [Q95SX8-1]

3D structure databases

SMRiQ95SX8
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi64530, 1 interactor
IntActiQ95SX8, 2 interactors
STRINGi7227.FBpp0089006

Proteomic databases

PaxDbiQ95SX8
PRIDEiQ95SX8

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
39142

Genome annotation databases

EnsemblMetazoaiFBtr0089410; FBpp0088430; FBgn0036039 [Q95SX8-2]
FBtr0089411; FBpp0089006; FBgn0036039 [Q95SX8-1]
FBtr0114566; FBpp0113058; FBgn0036039 [Q95SX8-3]
GeneIDi39142
KEGGidme:Dmel_CG18177
UCSCiCG18177-RA, d. melanogaster [Q95SX8-1]
CG18177-RB, d. melanogaster

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
79903
FlyBaseiFBgn0036039, Naa60

Phylogenomic databases

eggNOGiKOG3138, Eukaryota
GeneTreeiENSGT00390000008314
InParanoidiQ95SX8
OMAiTVKQLCG
PhylomeDBiQ95SX8

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
39142, 0 hits in 1 CRISPR screen

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
39142

Protein Ontology

More...
PROi
PR:Q95SX8

Gene expression databases

BgeeiFBgn0036039, Expressed in embryo and 39 other tissues
GenevisibleiQ95SX8, DM

Family and domain databases

InterProiView protein in InterPro
IPR016181, Acyl_CoA_acyltransferase
IPR000182, GNAT_dom
PfamiView protein in Pfam
PF00583, Acetyltransf_1, 1 hit
SUPFAMiSSF55729, SSF55729, 1 hit
PROSITEiView protein in PROSITE
PS51186, GNAT, 1 hit

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiNAA60_DROME
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q95SX8
Secondary accession number(s): B7Z0F9, Q8IH11, Q9VT42
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 19, 2011
Last sequence update: December 1, 2001
Last modified: June 2, 2021
This is version 128 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programDrosophila annotation project

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Drosophila
    Drosophila: entries, gene names and cross-references to FlyBase
  2. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again