Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 97 (07 Oct 2020)
Sequence version 2 (24 Mar 2009)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

GDSL esterase/lipase EXL5

Gene

EXL5

Organism
Arabidopsis thaliana (Mouse-ear cress)
Status
Reviewed-Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei36NucleophileBy similarity1
Active sitei333By similarity1
Active sitei336By similarity1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionHydrolase
Biological processLipid degradation, Lipid metabolism

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
GDSL esterase/lipase EXL5 (EC:3.1.1.-)
Alternative name(s):
Family II extracellular lipase 5
Short name:
Family II lipase EXL5
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:EXL5
Ordered Locus Names:At1g75920
ORF Names:T4O12.14
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiArabidopsis thaliana (Mouse-ear cress)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri3702 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaViridiplantaeStreptophytaEmbryophytaTracheophytaSpermatophytaMagnoliopsidaeudicotyledonsGunneridaePentapetalaerosidsmalvidsBrassicalesBrassicaceaeCamelineaeArabidopsis
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000006548 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 1

Organism-specific databases

Arabidopsis Information Portal

More...
Araporti
AT1G75920

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cell wall Cytoskeleton Vacuole Chloroplast Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertion Graphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Secreted

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 21Sequence analysisAdd BLAST21
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000036733222 – 358GDSL esterase/lipase EXL5Add BLAST337

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi24N-linked (GlcNAc...) asparagineSequence analysis1

Keywords - PTMi

Glycoprotein

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q94CH5

PRoteomics IDEntifications database

More...
PRIDEi
Q94CH5

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
222234 [Q94CH5-1]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q94CH5

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Flower buds.1 Publication

Gene expression databases

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q94CH5, baseline and differential

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
29144, 1 interactor

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the 'GDSL' lipolytic enzyme family.Curated

Keywords - Domaini

Signal

Phylogenomic databases

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q94CH5

Identification of Orthologs from Complete Genome Data

More...
OMAi
KSWRGES

Database of Orthologous Groups

More...
OrthoDBi
704138at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q94CH5

Family and domain databases

Conserved Domains Database

More...
CDDi
cd01837, SGNH_plant_lipase_like, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
3.40.50.1110, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR001087, GDSL
IPR008265, Lipase_GDSL_AS
IPR036514, SGNH_hydro_sf
IPR035669, SGNH_plant_lipase-like

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00657, Lipase_GDSL, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS01098, LIPASE_GDSL_SER, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q94CH5-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MFRKKMLVLA LFSIYFLSIE AVRNESFPAL LAFGDSMVDT GNNNYLLTLM
60 70 80 90 100
KGNYWPYGWN FDSKIPTGRF GNGRVFSDVV GIILKSSLQC FFVISAEGLG
110 120 130 140 150
IKRIVPAYRK LYIAPSDLKT GVSFASGGAG VDPVTSKLLR VLSPADQVKD
160 170 180 190 200
FKGYKRKLKG VVGRSKAKKI VANSVILVSE GNNDIGITYA IHDAGMRLMT
210 220 230 240 250
PKVYTSKLVG WNKKFIKDLY DHGARKFAVM GVIPLGCLPM SRLIFGGFFV
260 270 280 290 300
WCNFLANTIS EDYNKKLKSG IKSWRGASDF RGARFVYVDM YNSLMDVINN
310 320 330 340 350
HRKYGFTHEK NGCCCMLTAI VPCSNPDKYV FYDFAHPSEK AYKTIAKKLV

EDIKTGLA
Length:358
Mass (Da):39,946
Last modified:March 24, 2009 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iBB410768A8EBF1FF
GO
Isoform 2 (identifier: Q94CH5-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     81-95: Missing.

Show »
Length:343
Mass (Da):38,309
Checksum:i63120217034A9124
GO
Isoform 3 (identifier: Q94CH5-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     82-127: Missing.

Show »
Length:312
Mass (Da):35,005
Checksum:iBA50610D8B97E280
GO
Isoform 4 (identifier: Q94CH5-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-51: MFRKKMLVLALFSIYFLSIEAVRNESFPALLAFGDSMVDTGNNNYLLTLMK → MACALRGPIETISAHQTMTSPLP
     81-95: Missing.

Show »
Length:315
Mass (Da):34,900
Checksum:i1BCF252C4ECE1EB3
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
F4I0R0F4I0R0_ARATH
GDSL-like Lipase/Acylhydrolase supe...
At1g75920, T4O12.14, T4O12_14
353Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAF26758 differs from that shown. Reason: Erroneous gene model prediction.Curated

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0366831 – 51MFRKK…LTLMK → MACALRGPIETISAHQTMTS PLP in isoform 4. CuratedAdd BLAST51
Alternative sequenceiVSP_03668481 – 95Missing in isoform 2 and isoform 4. 1 PublicationAdd BLAST15
Alternative sequenceiVSP_03668582 – 127Missing in isoform 3. CuratedAdd BLAST46

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AC007396 Genomic DNA Translation: AAF26758.2 Sequence problems.
CP002684 Genomic DNA Translation: AEE35775.1
CP002684 Genomic DNA Translation: AEE35776.1
CP002684 Genomic DNA Translation: AEE35777.1
AY028613 mRNA Translation: AAK30020.1
DQ446435 mRNA Translation: ABE65778.1

NCBI Reference Sequences

More...
RefSeqi
NP_001077830.1, NM_001084361.2 [Q94CH5-2]
NP_001077831.1, NM_001084362.1 [Q94CH5-3]
NP_001117605.1, NM_001124133.2 [Q94CH5-4]
NP_565122.1, NM_106242.2

Genome annotation databases

Ensembl plant genome annotation project

More...
EnsemblPlantsi
AT1G75920.1; AT1G75920.1; AT1G75920
AT1G75920.2; AT1G75920.2; AT1G75920 [Q94CH5-2]
AT1G75920.3; AT1G75920.3; AT1G75920 [Q94CH5-3]
AT1G75920.4; AT1G75920.4; AT1G75920 [Q94CH5-4]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
843925

Gramene; a comparative resource for plants

More...
Gramenei
AT1G75920.1; AT1G75920.1; AT1G75920
AT1G75920.2; AT1G75920.2; AT1G75920 [Q94CH5-2]
AT1G75920.3; AT1G75920.3; AT1G75920 [Q94CH5-3]
AT1G75920.4; AT1G75920.4; AT1G75920 [Q94CH5-4]

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
ath:AT1G75920

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AC007396 Genomic DNA Translation: AAF26758.2 Sequence problems.
CP002684 Genomic DNA Translation: AEE35775.1
CP002684 Genomic DNA Translation: AEE35776.1
CP002684 Genomic DNA Translation: AEE35777.1
AY028613 mRNA Translation: AAK30020.1
DQ446435 mRNA Translation: ABE65778.1
RefSeqiNP_001077830.1, NM_001084361.2 [Q94CH5-2]
NP_001077831.1, NM_001084362.1 [Q94CH5-3]
NP_001117605.1, NM_001124133.2 [Q94CH5-4]
NP_565122.1, NM_106242.2

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

BioGRIDi29144, 1 interactor

PTM databases

iPTMnetiQ94CH5

Proteomic databases

PaxDbiQ94CH5
PRIDEiQ94CH5
ProteomicsDBi222234 [Q94CH5-1]

Genome annotation databases

EnsemblPlantsiAT1G75920.1; AT1G75920.1; AT1G75920
AT1G75920.2; AT1G75920.2; AT1G75920 [Q94CH5-2]
AT1G75920.3; AT1G75920.3; AT1G75920 [Q94CH5-3]
AT1G75920.4; AT1G75920.4; AT1G75920 [Q94CH5-4]
GeneIDi843925
GrameneiAT1G75920.1; AT1G75920.1; AT1G75920
AT1G75920.2; AT1G75920.2; AT1G75920 [Q94CH5-2]
AT1G75920.3; AT1G75920.3; AT1G75920 [Q94CH5-3]
AT1G75920.4; AT1G75920.4; AT1G75920 [Q94CH5-4]
KEGGiath:AT1G75920

Organism-specific databases

AraportiAT1G75920

Phylogenomic databases

InParanoidiQ94CH5
OMAiKSWRGES
OrthoDBi704138at2759
PhylomeDBiQ94CH5

Miscellaneous databases

Protein Ontology

More...
PROi
PR:Q94CH5

Gene expression databases

ExpressionAtlasiQ94CH5, baseline and differential

Family and domain databases

CDDicd01837, SGNH_plant_lipase_like, 1 hit
Gene3Di3.40.50.1110, 1 hit
InterProiView protein in InterPro
IPR001087, GDSL
IPR008265, Lipase_GDSL_AS
IPR036514, SGNH_hydro_sf
IPR035669, SGNH_plant_lipase-like
PfamiView protein in Pfam
PF00657, Lipase_GDSL, 1 hit
PROSITEiView protein in PROSITE
PS01098, LIPASE_GDSL_SER, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiEXL5_ARATH
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q94CH5
Secondary accession number(s): A8MR69
, B3H6N8, Q1PFC8, Q9LQS4
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: March 24, 2009
Last sequence update: March 24, 2009
Last modified: October 7, 2020
This is version 97 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programPlant Protein Annotation Program

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Arabidopsis thaliana
    Arabidopsis thaliana: entries and gene names
  2. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again