Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 107 (18 Sep 2019)
Sequence version 1 (01 Dec 2001)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Acetolactate synthase small subunit 2, chloroplastic

Gene

At2g31810

Organism
Arabidopsis thaliana (Mouse-ear cress)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Regulatory subunit of acetohydroxy-acid synthase. Involved in the feed-back inhibition by branched-chain amino acids. Contains 2 repeats, each of them being able to activate partially the catalytic subunit. The enzyme reconstituted with the first repeat is inhibited by leucine, but not by valine or isoleucine and the enzyme reconstituted with the second repeat is not inhibited by any branched-chain amino acid.2 Publications

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section describes the metabolic pathway(s) associated with a protein.<p><a href='/help/pathway' target='_top'>More...</a></p>Pathwayi: L-isoleucine biosynthesis

This protein is involved in step 1 of the subpathway that synthesizes L-isoleucine from 2-oxobutanoate.
Proteins known to be involved in the 4 steps of the subpathway in this organism are:
  1. Acetolactate synthase small subunit 1, chloroplastic (VAT1), Acetolactate synthase, chloroplastic (ALS), Acetolactate synthase (AXX17_At3g42690), Acetolactate synthase small subunit 2, chloroplastic (At2g31810)
  2. Ketol-acid reductoisomerase, chloroplastic (At3g58610), Ketol-acid reductoisomerase (AXX17_At3g53150), Ketol-acid reductoisomerase (At3g58610)
  3. Dihydroxy-acid dehydratase, chloroplastic (DHAD)
  4. Branched-chain-amino-acid aminotransferase 2, chloroplastic (BCAT2), Branched-chain-amino-acid aminotransferase 5, chloroplastic (BCAT5), Branched-chain-amino-acid aminotransferase 3, chloroplastic (BCAT3), Branched-chain-amino-acid aminotransferase 6 (BCAT6)
This subpathway is part of the pathway L-isoleucine biosynthesis, which is itself part of Amino-acid biosynthesis.
View all proteins of this organism that are known to be involved in the subpathway that synthesizes L-isoleucine from 2-oxobutanoate, the pathway L-isoleucine biosynthesis and in Amino-acid biosynthesis.

Pathwayi: L-valine biosynthesis

This protein is involved in step 1 of the subpathway that synthesizes L-valine from pyruvate.
Proteins known to be involved in the 4 steps of the subpathway in this organism are:
  1. Acetolactate synthase small subunit 1, chloroplastic (VAT1), Acetolactate synthase, chloroplastic (ALS), Acetolactate synthase (AXX17_At3g42690), Acetolactate synthase small subunit 2, chloroplastic (At2g31810)
  2. Ketol-acid reductoisomerase, chloroplastic (At3g58610), Ketol-acid reductoisomerase (AXX17_At3g53150), Ketol-acid reductoisomerase (At3g58610)
  3. Dihydroxy-acid dehydratase, chloroplastic (DHAD)
  4. Branched-chain-amino-acid aminotransferase 2, chloroplastic (BCAT2), Branched-chain-amino-acid aminotransferase 5, chloroplastic (BCAT5), Branched-chain-amino-acid aminotransferase 3, chloroplastic (BCAT3), Branched-chain-amino-acid aminotransferase 6 (BCAT6)
This subpathway is part of the pathway L-valine biosynthesis, which is itself part of Amino-acid biosynthesis.
View all proteins of this organism that are known to be involved in the subpathway that synthesizes L-valine from pyruvate, the pathway L-valine biosynthesis and in Amino-acid biosynthesis.

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processAmino-acid biosynthesis, Branched-chain amino acid biosynthesis

Enzyme and pathway databases

BioCyc Collection of Pathway/Genome Databases

More...
BioCyci
ARA:AT2G31810-MONOMER

UniPathway: a resource for the exploration and annotation of metabolic pathways

More...
UniPathwayi
UPA00047;UER00055
UPA00049;UER00059

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Acetolactate synthase small subunit 2, chloroplastic
Alternative name(s):
Acetohydroxy-acid synthase small subunit
Short name:
AHAS
Short name:
ALS
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Ordered Locus Names:At2g31810
ORF Names:F20M17.15
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiArabidopsis thaliana (Mouse-ear cress)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri3702 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaViridiplantaeStreptophytaEmbryophytaTracheophytaSpermatophytaMagnoliopsidaeudicotyledonsGunneridaePentapetalaerosidsmalvidsBrassicalesBrassicaceaeCamelineaeArabidopsis
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000006548 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 2

Organism-specific databases

Arabidopsis Information Portal

More...
Araporti
AT2G31810

The Arabidopsis Information Resource

More...
TAIRi
locus:2045248 AT2G31810

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cell wall Cytoskeleton Vacuole Chloroplast Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertion Graphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Chloroplast, Plastid

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi98G → E: Increased feedback inhibition by valine/isoleucine. 1 Publication1
Mutagenesisi107F → A: Decreased feedback inhibition by leucine and valine/isoleucine. 1 Publication1
Mutagenesisi112Y → A: Increased feedback inhibition by leucine. 1 Publication1
Mutagenesisi113N → A: Decreased feedback inhibition by valine/isoleucine. 1 Publication1
Mutagenesisi331G → D: Decreased feedback inhibition by leucine and valine/isoleucine. 1 Publication1
Mutagenesisi340F → A: Decreased feedback inhibition by valine/isoleucine. 1 Publication1
Mutagenesisi345Y → A: No effect. 1 Publication1
Mutagenesisi346N → A or H: Decreased feedback inhibition by leucine and increased feedback inhibition by valine/isoleucine. 1 Publication1

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a transit peptide.<p><a href='/help/transit' target='_top'>More...</a></p>Transit peptidei1 – 27ChloroplastSequence analysisAdd BLAST27
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000042086628 – 491Acetolactate synthase small subunit 2, chloroplasticAdd BLAST464

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q93YZ7

PRoteomics IDEntifications database

More...
PRIDEi
Q93YZ7

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q93YZ7 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q93YZ7 AT

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

The acetolactate synthase complex contains both large catalytic subunits and small regulatory subunits. The active enzyme may have an alpha4beta4 structure (Probable).

1 Publication

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
3085, 1 interactor

STRING: functional protein association networks

More...
STRINGi
3702.AT2G31810.1

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q93YZ7

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini88 – 160ACT 1PROSITE-ProRule annotationAdd BLAST73
Domaini321 – 395ACT 2PROSITE-ProRule annotationAdd BLAST75

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi5 – 46Ser-richAdd BLAST42

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Keywords - Domaini

Repeat, Transit peptide

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG2663 Eukaryota
COG0440 LUCA

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000265291

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q93YZ7

KEGG Orthology (KO)

More...
KOi
K01653

Identification of Orthologs from Complete Genome Data

More...
OMAi
DVYPVEQ

Database of Orthologous Groups

More...
OrthoDBi
582538at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q93YZ7

Family and domain databases

Conserved Domains Database

More...
CDDi
cd04878 ACT_AHAS, 2 hits

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
3.30.70.1150, 2 hits

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR004789 Acetalactate_synth_ssu
IPR027271 Acetolactate_synth/TF_NikR_C
IPR019455 Acetolactate_synth_ssu_C
IPR002912 ACT_dom
IPR039557 AHAS_ACT

The PANTHER Classification System

More...
PANTHERi
PTHR30239 PTHR30239, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF01842 ACT, 1 hit
PF10369 ALS_ss_C, 2 hits

TIGRFAMs; a protein family database

More...
TIGRFAMsi
TIGR00119 acolac_sm, 2 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS51671 ACT, 2 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q93YZ7-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAAISVSSSP SIRCLRSACS DSSPALVSST RVSFPAKISY LSGISSHRGD
60 70 80 90 100
EMGKRMEGFV RSVDGKISDA SFSEASSATP KSKVRKHTIS VFVGDESGMI
110 120 130 140 150
NRIAGVFARR GYNIESLAVG LNRDKALFTI VVCGTERVLQ QVIEQLQKLV
160 170 180 190 200
NVLKVEDISS EPQVERELML VKVNAHPESR AEIMWLVDTF RARVVDIAEH
210 220 230 240 250
ALTIEVTGDP GKMIAVERNL KKFQIREIVR TGKIALRREK MGATAPFWRF
260 270 280 290 300
SAASYPDLKE QAPVSVLRSS KKGAIVPQKE TSAGGDVYPV EPFFDPKVHR
310 320 330 340 350
ILDAHWGLLT DEDTSGLRSH TLSLLVNDIP GVLNIVTGVF ARRGYNIQSL
360 370 380 390 400
AVGHAETKGI SRITTVIPAT DESVSKLVQQ LYKLVDVHEV HDLTHLPFSE
410 420 430 440 450
RELMLIKIAV NAAARRDVLD IASIFRAKAV DVSDHTITLQ LTGDLDKMVA
460 470 480 490
LQRLLEPYGI CEVARTGRVA LARESGVDSK YLRGYSFPLT G
Length:491
Mass (Da):53,873
Last modified:December 1, 2001 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iA6800F3235E74D2E
GO
Isoform 2 (identifier: Q93YZ7-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-105: MAAISVSSSP...ESGMINRIAG → MKWVREWKDSLEASMGRSLMRLSPKLHLRLQNRR
     349-349: S → AY

Show »
Length:421
Mass (Da):47,228
Checksum:i04963A6DC974A5BE
GO
Isoform 3 (identifier: Q93YZ7-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     441-464: LTGDLDKMVALQRLLEPYGICEVA → VA

Show »
Length:469
Mass (Da):51,413
Checksum:i430B85BBF0F439B5
GO

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAD32291 differs from that shown. Reason: Erroneous gene model prediction.Curated

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0447661 – 105MAAIS…NRIAG → MKWVREWKDSLEASMGRSLM RLSPKLHLRLQNRR in isoform 2. CuratedAdd BLAST105
Alternative sequenceiVSP_044767349S → AY in isoform 2. Curated1
Alternative sequenceiVSP_044768441 – 464LTGDL…ICEVA → VA in isoform 3. CuratedAdd BLAST24

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AC006533 Genomic DNA Translation: AAD32291.1 Sequence problems.
CP002685 Genomic DNA Translation: AEC08586.1
CP002685 Genomic DNA Translation: AEC08587.1
CP002685 Genomic DNA Translation: AEC08588.1
AY058881 mRNA Translation: AAL24267.1
AY103307 mRNA Translation: AAM65359.1
AK318696 mRNA Translation: BAH56811.1

Protein sequence database of the Protein Information Resource

More...
PIRi
D84725

NCBI Reference Sequences

More...
RefSeqi
NP_850172.1, NM_179841.3 [Q93YZ7-1]
NP_850173.2, NM_179842.2 [Q93YZ7-2]
NP_850174.1, NM_179843.1 [Q93YZ7-3]

Genome annotation databases

Ensembl plant genome annotation project

More...
EnsemblPlantsi
AT2G31810.1; AT2G31810.1; AT2G31810 [Q93YZ7-1]
AT2G31810.2; AT2G31810.2; AT2G31810 [Q93YZ7-2]
AT2G31810.3; AT2G31810.3; AT2G31810 [Q93YZ7-3]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
817738

Gramene; a comparative resource for plants

More...
Gramenei
AT2G31810.1; AT2G31810.1; AT2G31810 [Q93YZ7-1]
AT2G31810.2; AT2G31810.2; AT2G31810 [Q93YZ7-2]
AT2G31810.3; AT2G31810.3; AT2G31810 [Q93YZ7-3]

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
ath:AT2G31810

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AC006533 Genomic DNA Translation: AAD32291.1 Sequence problems.
CP002685 Genomic DNA Translation: AEC08586.1
CP002685 Genomic DNA Translation: AEC08587.1
CP002685 Genomic DNA Translation: AEC08588.1
AY058881 mRNA Translation: AAL24267.1
AY103307 mRNA Translation: AAM65359.1
AK318696 mRNA Translation: BAH56811.1
PIRiD84725
RefSeqiNP_850172.1, NM_179841.3 [Q93YZ7-1]
NP_850173.2, NM_179842.2 [Q93YZ7-2]
NP_850174.1, NM_179843.1 [Q93YZ7-3]

3D structure databases

SMRiQ93YZ7
ModBaseiSearch...

Protein-protein interaction databases

BioGridi3085, 1 interactor
STRINGi3702.AT2G31810.1

Proteomic databases

PaxDbiQ93YZ7
PRIDEiQ93YZ7

Genome annotation databases

EnsemblPlantsiAT2G31810.1; AT2G31810.1; AT2G31810 [Q93YZ7-1]
AT2G31810.2; AT2G31810.2; AT2G31810 [Q93YZ7-2]
AT2G31810.3; AT2G31810.3; AT2G31810 [Q93YZ7-3]
GeneIDi817738
GrameneiAT2G31810.1; AT2G31810.1; AT2G31810 [Q93YZ7-1]
AT2G31810.2; AT2G31810.2; AT2G31810 [Q93YZ7-2]
AT2G31810.3; AT2G31810.3; AT2G31810 [Q93YZ7-3]
KEGGiath:AT2G31810

Organism-specific databases

AraportiAT2G31810
TAIRilocus:2045248 AT2G31810

Phylogenomic databases

eggNOGiKOG2663 Eukaryota
COG0440 LUCA
HOGENOMiHOG000265291
InParanoidiQ93YZ7
KOiK01653
OMAiDVYPVEQ
OrthoDBi582538at2759
PhylomeDBiQ93YZ7

Enzyme and pathway databases

UniPathwayiUPA00047;UER00055
UPA00049;UER00059
BioCyciARA:AT2G31810-MONOMER

Miscellaneous databases

Protein Ontology

More...
PROi
PR:Q93YZ7

Gene expression databases

ExpressionAtlasiQ93YZ7 baseline and differential
GenevisibleiQ93YZ7 AT

Family and domain databases

CDDicd04878 ACT_AHAS, 2 hits
Gene3Di3.30.70.1150, 2 hits
InterProiView protein in InterPro
IPR004789 Acetalactate_synth_ssu
IPR027271 Acetolactate_synth/TF_NikR_C
IPR019455 Acetolactate_synth_ssu_C
IPR002912 ACT_dom
IPR039557 AHAS_ACT
PANTHERiPTHR30239 PTHR30239, 1 hit
PfamiView protein in Pfam
PF01842 ACT, 1 hit
PF10369 ALS_ss_C, 2 hits
TIGRFAMsiTIGR00119 acolac_sm, 2 hits
PROSITEiView protein in PROSITE
PS51671 ACT, 2 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiILVH2_ARATH
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q93YZ7
Secondary accession number(s): C0Z282
, F4IRS9, Q3E6W5, Q9SKB9
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: January 9, 2013
Last sequence update: December 1, 2001
Last modified: September 18, 2019
This is version 107 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programPlant Protein Annotation Program

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Arabidopsis thaliana
    Arabidopsis thaliana: entries and gene names
  3. PATHWAY comments
    Index of metabolic and biosynthesis pathways
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again