We will be switching to the new UniProt website soon. Please explore and share your feedback. Take me to the new website.

UniProtKB - Q93088 (BHMT1_HUMAN)

>sp|Q93088|BHMT1_HUMAN Betaine--homocysteine S-methyltransferase 1 OS=Homo sapiens OX=9606 GN=BHMT PE=1 SV=2
MPPVGGKKAKKGILERLNAGEIVIGDGGFVFALEKRGYVKAGPWTPEAAVEHPEAVRQLH
REFLRAGSNVMQTFTFYASEDKLENRGNYVLEKISGQEVNEAACDIARQVADEGDALVAG
GVSQTPSYLSCKSETEVKKVFLQQLEVFMKKNVDFLIAEYFEHVEEAVWAVETLIASGKP
VAATMCIGPEGDLHGVPPGECAVRLVKAGASIIGVNCHFDPTISLKTVKLMKEGLEAARL
KAHLMSQPLAYHTPDCNKQGFIDLPEFPFGLEPRVATRWDIQKYAREAYNLGVRYIGGCC
GFEPYHIRAIAEELAPERGFLPPASEKHGSWGSGLDMHTKPWVRARARKEYWENLRIASG
RPYNPSMSKPDGWGVTKGTAELMQQKEATTEQQLKELFEKQKFKSQ

Entry version 191 (23 Feb 2022)
Sequence version 2 (17 Apr 2007)
Previous versions | rss

Add a publication Feedback

Protein

Betaine--homocysteine S-methyltransferase 1

Gene

BHMT

Organism

Homo sapiens (Human)

Status

Reviewed-Annotation score: -Experimental evidence at protein levelⁱ

Functionⁱ

Involved in the regulation of homocysteine metabolism. Converts betaine and homocysteine to dimethylglycine and methionine, respectively. This reaction is also required for the irreversible oxidation of choline.

Catalytic activityⁱ

glycine betaine
Search proteins in UniProtKB for this molecule.
Search chemical reactions in Rhea for this molecule.
See the description of this molecule in ChEBI.
+
L-homocysteine
Search proteins in UniProtKB for this molecule.
Search chemical reactions in Rhea for this molecule.
See the description of this molecule in ChEBI.
=
L-methionine
Search proteins in UniProtKB for this molecule.
Search chemical reactions in Rhea for this molecule.
See the description of this molecule in ChEBI.
+
N,N-dimethylglycine
Search proteins in UniProtKB for this molecule.
Search chemical reactions in Rhea for this molecule.
See the description of this molecule in ChEBI.
EC:
2.1.1.5
- Search proteins in UniProtKB for this EC number.
- See the description of this EC number in ENZYME.
- Search reactions for this EC number in Rhea.
Source:
Rhea
Search for this reaction in UniProtKB.
See the description of this reaction in Rhea.
. Show »« Hide
glycine betaine
zoom
+
L-homocysteine
zoom
=
L-methionine
zoom
+
N,N-dimethylglycine
zoom

Cofactorⁱ

Zn²⁺Note: Binds 1 zinc ion per subunit.

Pathwayⁱ: betaine degradation

This protein is involved in step 1 of the subpathway that synthesizes sarcosine from betaine. This subpathway is part of the pathway betaine degradation, which is itself part of Amine and polyamine degradation.
View all proteins of this organism that are known to be involved in the subpathway that synthesizes sarcosine from betaine, the pathway betaine degradation and in Amine and polyamine degradation.

Pathwayⁱ: L-methionine biosynthesis via de novo pathway

This protein is involved in step 1 of the subpathway that synthesizes L-methionine from L-homocysteine (BhmT route). This subpathway is part of the pathway L-methionine biosynthesis via de novo pathway, which is itself part of Amino-acid biosynthesis.
View all proteins of this organism that are known to be involved in the subpathway that synthesizes L-methionine from L-homocysteine (BhmT route), the pathway L-methionine biosynthesis via de novo pathway and in Amino-acid biosynthesis.

Sites

Feature key	Position(s)	DescriptionActions	Length
Metal bindingⁱ	217	Zinc	1
Metal bindingⁱ	299	Zinc	1
Metal bindingⁱ	300	Zinc	1

GO - Molecular functionⁱ

Complete GO annotation on QuickGO ...

GO - Biological processⁱ

Complete GO annotation on QuickGO ...

Keywordsⁱ

Molecular function	Methyltransferase, Transferase
Ligand	Metal-binding, Zinc

Enzyme and pathway databases

BRENDAⁱ	2.1.1.5, 2681
PathwayCommonsⁱ	Q93088
Reactomeⁱ	R-HSA-1614635, Sulfur amino acid metabolism R-HSA-6798163, Choline catabolism
SABIO-RKⁱ	Q93088
SignaLinkⁱ	Q93088
SIGNORⁱ	Q93088
UniPathwayⁱ	UPA00051;UER00083 UPA00291;UER00432

Names & Taxonomyⁱ

Protein namesⁱ	Recommended name: Betaine--homocysteine S-methyltransferase 1 (EC:2.1.1.5)
Gene namesⁱ	Name:BHMT
Organismⁱ	Homo sapiens (Human)
Taxonomic identifierⁱ	9606 [NCBI]
Taxonomic lineageⁱ	cellular organisms › Eukaryota › Opisthokonta › Metazoa › Eumetazoa › Bilateria › Deuterostomia › Chordata › Craniata › Vertebrata › Gnathostomata › Teleostomi › Euteleostomi › Sarcopterygii › Dipnotetrapodomorpha › Tetrapoda › Amniota › Mammalia › Theria › Eutheria › Boreoeutheria › Euarchontoglires › Primates › Haplorrhini › Simiiformes › Catarrhini › Hominoidea › Hominidae › Homininae › Homo
Proteomesⁱ	UP000005640 Componentⁱ: Chromosome 5

Organism-specific databases

Human Gene Nomenclature Database More...HGNCⁱ	HGNC:1047, BHMT
MIMⁱ	602888, gene
neXtProtⁱ	NX_Q93088
VEuPathDBⁱ	HostDB:ENSG00000145692

Keywords - Cellular componentⁱ

Cytoplasm

Pathology & Biotechⁱ

Organism-specific databases

DisGeNET More...DisGeNETⁱ	635
Open Targets More...OpenTargetsⁱ	ENSG00000145692
PharmGKBⁱ	PA25350

Miscellaneous databases

Pharosⁱ	Q93088, Tchem

Pharosⁱ

Q93088, Tchem

Chemistry databases

ChEMBLⁱ	CHEMBL4328
Drug and drug target database More...DrugBankⁱ	DB00134, Methionine DB02337, S-(D-Carboxybutyl)-L-Homocysteine

Genetic variation databases

BioMutaⁱ	BHMT
DMDMⁱ	145559446

PTM / Processingⁱ

Molecule processing

Feature key	Position(s)	DescriptionActions	Graphical view	Length
ChainⁱPRO_0000114621	1 – 406	Betaine--homocysteine S-methyltransferase 1Add BLAST		406

Amino acid modifications

Feature key	Position(s)	DescriptionActions	Length
Modified residueⁱ	40	N6-succinyllysineBy similarity	1
Modified residueⁱ	93	N6-succinyllysineBy similarity	1
Modified residueⁱ	232	N6-succinyllysineBy similarity	1
Modified residueⁱ	241	N6-succinyllysineBy similarity	1
Modified residueⁱ	330	PhosphoserineBy similarity	1
Modified residueⁱ	340	N6-succinyllysineBy similarity	1
Modified residueⁱ	377	N6-succinyllysineBy similarity	1

Keywords - PTMⁱ

Phosphoprotein

Proteomic databases

EPDⁱ	Q93088
jPOSTⁱ	Q93088
MassIVEⁱ	Q93088
PaxDbⁱ	Q93088
PeptideAtlas More...PeptideAtlasⁱ	Q93088
PRIDEⁱ	Q93088
ProteomicsDBⁱ	75719

PTM databases

GlyGenⁱ	Q93088, 1 site, 1 O-linked glycan (1 site)
iPTMnetⁱ	Q93088
PhosphoSitePlusⁱ	Q93088

Expressionⁱ

Tissue specificityⁱ

Found exclusively in liver and kidney.1 Publication

Gene expression databases

Bgeeⁱ	ENSG00000145692, Expressed in adult mammalian kidney and 120 other tissues
ExpressionAtlasⁱ	Q93088, baseline and differential
Genevisibleⁱ	Q93088, HS

Organism-specific databases

Human Protein Atlas More...HPAⁱ	ENSG00000145692, Group enriched (kidney, liver)

HPAⁱ

ENSG00000145692, Group enriched (kidney, liver)

Interactionⁱ

Subunit structureⁱ

Homotetramer.

1 Publication

Protein-protein interaction databases

BioGRIDⁱ	107104, 12 interactors
IntActⁱ	Q93088, 7 interactors
Molecular INTeraction database More...MINTⁱ	Q93088
STRINGⁱ	9606.ENSP00000274353

Chemistry databases

BindingDBⁱ

Q93088

Miscellaneous databases

RNActⁱ	Q93088, protein

RNActⁱ

Q93088, protein

Structureⁱ

Secondary structure

Legend: HelixTurnBeta strandPDB Structure known for this area

Feature key	Position(s)	DescriptionActions	Length
Helixⁱ	13 – 18	Combined sources	6
Helixⁱ	29 – 35	Combined sources	7
Turnⁱ	41 – 43	Combined sources	3
Helixⁱ	48 – 51	Combined sources	4
Helixⁱ	53 – 66	Combined sources	14
Beta strandⁱ	69 – 72	Combined sources	4
Helixⁱ	97 – 111	Combined sources	15
Turnⁱ	112 – 115	Combined sources	4
Beta strandⁱ	117 – 123	Combined sources	7
Helixⁱ	126 – 129	Combined sources	4
Helixⁱ	134 – 151	Combined sources	18
Beta strandⁱ	154 – 162	Combined sources	9
Helixⁱ	164 – 175	Combined sources	12
Beta strandⁱ	181 – 185	Combined sources	5
Helixⁱ	198 – 207	Combined sources	10
Beta strandⁱ	211 – 219	Combined sources	9
Helixⁱ	221 – 237	Combined sources	17
Beta strandⁱ	243 – 247	Combined sources	5
Helixⁱ	261 – 263	Combined sources	3
Turnⁱ	265 – 269	Combined sources	5
Helixⁱ	272 – 274	Combined sources	3
Helixⁱ	278 – 290	Combined sources	13
Beta strandⁱ	293 – 296	Combined sources	4
Helixⁱ	304 – 313	Combined sources	10
Helixⁱ	315 – 318	Combined sources	4
Helixⁱ	323 – 327	Combined sources	5
Helixⁱ	330 – 335	Combined sources	6
Helixⁱ	341 – 344	Combined sources	4
Helixⁱ	349 – 354	Combined sources	6
Helixⁱ	377 – 400	Combined sources	24

Show more details

3D structure databases

SMRⁱ	Q93088
ModBaseⁱ	Search...
PDBe-KBⁱ	Search...

Miscellaneous databases

EvolutionaryTraceⁱ	Q93088

EvolutionaryTraceⁱ

Q93088

Family & Domainsⁱ

Domains and Repeats

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Domainⁱ	11 – 314	Hcy-bindingPROSITE-ProRule annotationAdd BLAST		304

Phylogenomic databases

eggNOGⁱ	KOG1579, Eukaryota
Ensembl GeneTree More...GeneTreeⁱ	ENSGT00390000003122
InParanoidⁱ	Q93088
OMAⁱ	AQPLAYH
Database of Orthologous Groups More...OrthoDBⁱ	731388at2759
PhylomeDBⁱ	Q93088
TreeFamⁱ	TF329202

Family and domain databases

Gene3Dⁱ	3.20.20.330, 1 hit
InterProⁱ	View protein in InterPro IPR017226, Betaine-hCys_S-MeTrfase_BHMT IPR003726, HCY_dom IPR036589, HCY_dom_sf
Pfam protein domain database More...Pfamⁱ	View protein in Pfam PF02574, S-methyl_trans, 1 hit
PIRSFⁱ	PIRSF037505, Betaine_HMT, 1 hit
SUPFAMⁱ	SSF82282, SSF82282, 1 hit
PROSITEⁱ	View protein in PROSITE PS50970, HCY, 1 hit

Sequence (1+)ⁱ

Sequence statusⁱ: Complete.

This entry has 1 described isoform and 1 potential isoform that is computationally mapped.Show all Align All

Q93088-1 [UniParc]FASTA Add to basket

« Hide

        10         20         30         40         50
MPPVGGKKAK KGILERLNAG EIVIGDGGFV FALEKRGYVK AGPWTPEAAV 
        60         70         80         90        100
EHPEAVRQLH REFLRAGSNV MQTFTFYASE DKLENRGNYV LEKISGQEVN 
       110        120        130        140        150
EAACDIARQV ADEGDALVAG GVSQTPSYLS CKSETEVKKV FLQQLEVFMK 
       160        170        180        190        200
KNVDFLIAEY FEHVEEAVWA VETLIASGKP VAATMCIGPE GDLHGVPPGE 
       210        220        230        240        250
CAVRLVKAGA SIIGVNCHFD PTISLKTVKL MKEGLEAARL KAHLMSQPLA 
       260        270        280        290        300
YHTPDCNKQG FIDLPEFPFG LEPRVATRWD IQKYAREAYN LGVRYIGGCC 
       310        320        330        340        350
GFEPYHIRAI AEELAPERGF LPPASEKHGS WGSGLDMHTK PWVRARARKE 
       360        370        380        390        400
YWENLRIASG RPYNPSMSKP DGWGVTKGTA ELMQQKEATT EQQLKELFEK 

QKFKSQ

Length:406

Mass (Da):44,998

Last modified:April 17, 2007 - v2

Checksum:ⁱ557855B8CEDD0D54

Computationally mapped potential isoform sequencesⁱ

There is 1 potential isoform mapped to this entry.BLAST Align Show all Add to basket

	Entry	Entry name		Protein names	Gene names	Length	Annotation

	E5RJH0	E5RJH0_HUMAN		Betaine--homocysteine S-methyltrans... Betaine--homocysteine S-methyltransferase 1	BHMT	253	Annotation score:

Natural variant

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Natural variantⁱVAR_061345	199	G → S. Corresponds to variant dbSNP:rs59866108EnsemblClinVar.		1
Natural variantⁱVAR_015886	239	R → Q May decrease risk for coronary artery disease. 2 PublicationsCorresponds to variant dbSNP:rs3733890Ensembl.		1

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	U50929 mRNA Translation: AAC50668.1 AF118378 AF118377 Genomic DNA Translation: AAD22043.1 BC012616 mRNA Translation: AAH12616.1
The Consensus CDS (CCDS) project More...CCDSⁱ	CCDS4046.1
NCBI Reference Sequences More...RefSeqⁱ	NP_001704.2, NM_001713.2

Genome annotation databases

Ensemblⁱ	ENST00000274353; ENSP00000274353; ENSG00000145692
GeneIDⁱ	635
KEGGⁱ	hsa:635
MANE-Selectⁱ	ENST00000274353.10; ENSP00000274353.5; NM_001713.3; NP_001704.2

Similar proteinsⁱ

100% Identity
90% Identity
50% Identity

Protein	Similar proteins		Species	Score	Length	Source
Q93088	Betaine-homocysteine methyltransferase, isoform CRA_a		HUMAN		406	UniRef100_Q93088

Protein	Similar proteins		Species	Score	Length	Source
Q93088	Betaine-homocysteine methyltransferase, isoform CRA_a		HUMAN		406	UniRef90_Q93088
Betaine--homocysteine S-methyltransferase		PROSS		407
Betaine--homocysteine S-methyltransferase		MICMU		407
Betaine--homocysteine S-methyltransferase		HORSE		407
cDNA, FLJ96222, highly similar to Homo sapiens betaine-homocysteine methyltransferase (BHMT), mRNA		HUMAN		406
+9

Protein	Similar proteins		Species	Score	Length	Source
Q93088	Betaine--homocysteine S-methyltransferase 1		BOVIN		407	UniRef50_Q93088
Betaine--homocysteine S-methyltransferase 1		MOUSE		407
Betaine--homocysteine S-methyltransferase 1		PONAB		406
Betaine--homocysteine S-methyltransferase 1 (Fragment)		PIG		278
Betaine-homocysteine methyltransferase, isoform CRA_a		HUMAN		406
+440

Cross-referencesⁱ

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	U50929 mRNA Translation: AAC50668.1 AF118378 AF118377 Genomic DNA Translation: AAD22043.1 BC012616 mRNA Translation: AAH12616.1
CCDSⁱ	CCDS4046.1
RefSeqⁱ	NP_001704.2, NM_001713.2

3D structure databases

Select the link destinations: Protein Data Bank Europe More...PDBeⁱ Protein Data Bank RCSB More...RCSB PDBⁱ Protein Data Bank Japan More...PDBjⁱ Links Updated	PDB entry	Method	Resolution (Å)	Chain	Positions	PDBsum
	1LT7	X-ray	2.15	A/B	1-406	[»]
	1LT8	X-ray	2.05	A/B	1-406	[»]
	4M3P	X-ray	1.90	A/B/C/D	1-406	[»]
SMRⁱ	Q93088
ModBaseⁱ	Search...
PDBe-KBⁱ	Search...

Protein-protein interaction databases

BioGRIDⁱ	107104, 12 interactors
IntActⁱ	Q93088, 7 interactors
MINTⁱ	Q93088
STRINGⁱ	9606.ENSP00000274353

Chemistry databases

BindingDBⁱ	Q93088
ChEMBLⁱ	CHEMBL4328
DrugBankⁱ	DB00134, Methionine DB02337, S-(D-Carboxybutyl)-L-Homocysteine

PTM databases

GlyGenⁱ	Q93088, 1 site, 1 O-linked glycan (1 site)
iPTMnetⁱ	Q93088
PhosphoSitePlusⁱ	Q93088

Genetic variation databases

BioMutaⁱ	BHMT
DMDMⁱ	145559446

Proteomic databases

EPDⁱ	Q93088
jPOSTⁱ	Q93088
MassIVEⁱ	Q93088
PaxDbⁱ	Q93088
PeptideAtlasⁱ	Q93088
PRIDEⁱ	Q93088
ProteomicsDBⁱ	75719

Protocols and materials databases

Antibodypediaⁱ	12660, 466 antibodies from 39 providers
The DNASU plasmid repository More...DNASUⁱ	635

Genome annotation databases

Ensemblⁱ	ENST00000274353; ENSP00000274353; ENSG00000145692
GeneIDⁱ	635
KEGGⁱ	hsa:635
MANE-Selectⁱ	ENST00000274353.10; ENSP00000274353.5; NM_001713.3; NP_001704.2

Organism-specific databases

CTDⁱ	635
DisGeNETⁱ	635
GeneCardsⁱ	BHMT
HGNCⁱ	HGNC:1047, BHMT
HPAⁱ	ENSG00000145692, Group enriched (kidney, liver)
MIMⁱ	602888, gene
neXtProtⁱ	NX_Q93088
OpenTargetsⁱ	ENSG00000145692
PharmGKBⁱ	PA25350
VEuPathDBⁱ	HostDB:ENSG00000145692
GenAtlas: human gene database More...GenAtlasⁱ	Search...

Phylogenomic databases

eggNOGⁱ	KOG1579, Eukaryota
GeneTreeⁱ	ENSGT00390000003122
InParanoidⁱ	Q93088
OMAⁱ	AQPLAYH
OrthoDBⁱ	731388at2759
PhylomeDBⁱ	Q93088
TreeFamⁱ	TF329202

Enzyme and pathway databases

UniPathwayⁱ	UPA00051;UER00083 UPA00291;UER00432
BRENDAⁱ	2.1.1.5, 2681
PathwayCommonsⁱ	Q93088
Reactomeⁱ	R-HSA-1614635, Sulfur amino acid metabolism R-HSA-6798163, Choline catabolism
SABIO-RKⁱ	Q93088
SignaLinkⁱ	Q93088
SIGNORⁱ	Q93088

Miscellaneous databases

BioGRID-ORCSⁱ	635, 9 hits in 1032 CRISPR screens
ChiTaRSⁱ	BHMT, human
EvolutionaryTraceⁱ	Q93088
GenomeRNAiⁱ	635
Pharosⁱ	Q93088, Tchem
Protein Ontology More...PROⁱ	PR:Q93088
RNActⁱ	Q93088, protein
SOURCEⁱ	Search...

Gene expression databases

Bgeeⁱ	ENSG00000145692, Expressed in adult mammalian kidney and 120 other tissues
ExpressionAtlasⁱ	Q93088, baseline and differential
Genevisibleⁱ	Q93088, HS

Family and domain databases

Gene3Dⁱ	3.20.20.330, 1 hit
InterProⁱ	View protein in InterPro IPR017226, Betaine-hCys_S-MeTrfase_BHMT IPR003726, HCY_dom IPR036589, HCY_dom_sf
Pfamⁱ	View protein in Pfam PF02574, S-methyl_trans, 1 hit
PIRSFⁱ	PIRSF037505, Betaine_HMT, 1 hit
SUPFAMⁱ	SSF82282, SSF82282, 1 hit
PROSITEⁱ	View protein in PROSITE PS50970, HCY, 1 hit
MobiDBⁱ	Search...

Entry informationⁱ

Entry nameⁱ	BHMT1_HUMAN
Accessionⁱ	Q93088Primary (citable) accession number: Q93088 Secondary accession number(s): Q9UNI9
Entry historyⁱ	Integrated into UniProtKB/Swiss-Prot:	November 1, 1997
	Last sequence update:	April 17, 2007
	Last modified:	February 23, 2022
	This is version 191 of the entry and version 2 of the sequence. See complete history.
Entry statusⁱ	Reviewed (UniProtKB/Swiss-Prot)
Annotation program	Chordata Protein Annotation Program
Disclaimer	Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousⁱ

Keywords - Technical termⁱ

3D-structure, Reference proteome

Documents

Human chromosome 5
Human chromosome 5: entries, gene names and cross-references to MIM
Human entries with genetic variants
List of human entries with genetic variants
Human variants curated from literature reports
Index of human variants curated from literature reports
MIM cross-references
Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
PATHWAY comments
Index of metabolic and biosynthesis pathways
PDB cross-references
Index of Protein Data Bank (PDB) cross-references

UniProtKB

UniParc

Help

UniRef

Proteomes

Annotation systems

Supporting data

UniProtKB - Q93088 (BHMT1_HUMAN)

Your basket is currently empty. i <p>When browsing through different UniProt proteins, you can use the 'basket' to save them, so that you can back to find or analyse them later.<p><a href='/help/basket' target='_top'>More...</a></p>

Betaine--homocysteine S-methyltransferase 1

BHMT

Select a section on the left to see content.

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section describes the metabolic pathway(s) associated with a protein.<p><a href='/help/pathway' target='_top'>More...</a></p>Pathwayi: betaine degradation

Pathwayi: L-methionine biosynthesis via de novo pathway

Sites

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

Enzyme and pathway databases

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

Organism-specific databases

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Cytoplasm and Cytosol

Cytosol

Extracellular region or secreted

Keywords - Cellular componenti

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

Miscellaneous databases

Chemistry databases

Genetic variation databases

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Amino acid modifications

Keywords - PTMi

Proteomic databases

PTM databases

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Organism-specific databases

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

Chemistry databases

Miscellaneous databases

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

3D structure databases

Miscellaneous databases

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Phylogenomic databases

Family and domain databases

Natural variant

Sequence databases

Genome annotation databases

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

3D structure databases

Protein-protein interaction databases

Chemistry databases

PTM databases

Genetic variation databases

Proteomic databases

Protocols and materials databases

Genome annotation databases

Organism-specific databases

Phylogenomic databases

Enzyme and pathway databases

Miscellaneous databases

Gene expression databases

Family and domain databases

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Documents

UniProt is an ELIXIR core data resource

Your basket is currently empty. ⁱ

Functionⁱ

Catalytic activityⁱ

Pathwayⁱ: betaine degradation

Pathwayⁱ: L-methionine biosynthesis via de novo pathway

GO - Molecular functionⁱ

GO - Biological processⁱ

Names & Taxonomyⁱ

Subcellular locationⁱ

Keywords - Cellular componentⁱ

Pathology & Biotechⁱ

PTM / Processingⁱ

Keywords - PTMⁱ

Expressionⁱ

Interactionⁱ

Structureⁱ

Family & Domainsⁱ

Cross-referencesⁱ

Entry informationⁱ

Miscellaneousⁱ

Keywords - Technical termⁱ