Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 206 (02 Jun 2021)
Sequence version 3 (02 Dec 2020)
Previous versions | rss
Add a publicationFeedback
Protein

Sarcoplasmic/endoplasmic reticulum calcium ATPase 3

Gene

ATP2A3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

This magnesium-dependent enzyme catalyzes the hydrolysis of ATP coupled with the transport of calcium. Transports calcium ions from the cytosol into the sarcoplasmic/endoplasmic reticulum lumen. Contributes to calcium sequestration involved in muscular excitation/contraction.

2 Publications

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes regulatory mechanisms for enzymes, transporters or microbial transcription factors, and reports the components which regulate (by activation or inhibition) the reaction.<p><a href='/help/activity_regulation' target='_top'>More...</a></p>Activity regulationi

Inhibited by sarcolipin (SLN), phospholamban (PLN) and myoregulin (MRLN) (By similarity). Enhanced by DWORF; DWORF increases activity by displacing sarcolipin (SLN), phospholamban (PLN) and myoregulin (MRLN) (By similarity).By similarity

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section indicates at which position the protein binds a given metal ion. The nature of the metal is indicated in the 'Description' field.<p><a href='/help/metal' target='_top'>More...</a></p>Metal bindingi304Calcium 2; via carbonyl oxygenBy similarity1
Metal bindingi305Calcium 2; via carbonyl oxygenBy similarity1
Metal bindingi307Calcium 2; via carbonyl oxygenBy similarity1
Metal bindingi309Calcium 2By similarity1
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei3514-aspartylphosphate intermediateBy similarity1
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the interaction between a single amino acid and another chemical entity. Priority is given to the annotation of physiological ligands.<p><a href='/help/binding' target='_top'>More...</a></p>Binding sitei515ATPBy similarity1
Metal bindingi703MagnesiumBy similarity1
Metal bindingi707MagnesiumBy similarity1
Metal bindingi768Calcium 1By similarity1
Metal bindingi771Calcium 1By similarity1
Metal bindingi796Calcium 2By similarity1
Metal bindingi799Calcium 1By similarity1
Metal bindingi800Calcium 1By similarity1
Metal bindingi800Calcium 2By similarity1
Metal bindingi908Calcium 1By similarity1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionTranslocase
Biological processCalcium transport, Ion transport, Transport
LigandATP-binding, Calcium, Magnesium, Metal-binding, Nucleotide-binding

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...
PathwayCommonsi
Q93084

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-1912420, Pre-NOTCH Processing in Golgi
R-HSA-418359, Reduction of cytosolic Ca++ levels
R-HSA-5578775, Ion homeostasis
R-HSA-936837, Ion transport by P-type ATPases

SIGNOR Signaling Network Open Resource

More...
SIGNORi
Q93084

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Sarcoplasmic/endoplasmic reticulum calcium ATPase 3Curated (EC:7.2.2.101 Publication)
Short name:
SERCA3
Short name:
SR Ca(2+)-ATPase 3
Alternative name(s):
Calcium pump 3
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:ATP2A3Imported
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 17

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:813, ATP2A3

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
601929, gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q93084

Eukaryotic Pathogen, Vector and Host Database Resources

More...
VEuPathDBi
HostDB:ENSG00000074370.17

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini1 – 48CytoplasmicBy similarityAdd BLAST48
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei49 – 69Helical; Name=1By similarityAdd BLAST21
Topological domaini70 – 89LumenalBy similarityAdd BLAST20
Transmembranei90 – 110Helical; Name=2By similarityAdd BLAST21
Topological domaini111 – 253CytoplasmicBy similarityAdd BLAST143
Transmembranei254 – 273Helical; Name=3By similarityAdd BLAST20
Topological domaini274 – 295LumenalBy similarityAdd BLAST22
Transmembranei296 – 313Helical; Name=4By similarityAdd BLAST18
Topological domaini314 – 757CytoplasmicBy similarityAdd BLAST444
Transmembranei758 – 777Helical; Name=5By similarityAdd BLAST20
Topological domaini778 – 787LumenalBy similarity10
Transmembranei788 – 808Helical; Name=6By similarityAdd BLAST21
Topological domaini809 – 828CytoplasmicBy similarityAdd BLAST20
Transmembranei829 – 851Helical; Name=7By similarityAdd BLAST23
Topological domaini852 – 897LumenalBy similarityAdd BLAST46
Transmembranei898 – 917Helical; Name=8By similarityAdd BLAST20
Topological domaini918 – 930CytoplasmicBy similarityAdd BLAST13
Transmembranei931 – 949Helical; Name=9By similarityAdd BLAST19
Topological domaini950 – 964LumenalBy similarityAdd BLAST15
Transmembranei965 – 985Helical; Name=10By similarityAdd BLAST21
Topological domaini986 – 999CytoplasmicBy similarityAdd BLAST14

Keywords - Cellular componenti

Endoplasmic reticulum, Membrane, Nucleus, Sarcoplasmic reticulum

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
489

Open Targets

More...
OpenTargetsi
ENSG00000074370

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA25106

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q93084, Tbio

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...
ChEMBLi
CHEMBL2401

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
ATP2A3

Domain mapping of disease mutations (DMDM)

More...
DMDMi
19864659

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000462021 – 999Sarcoplasmic/endoplasmic reticulum calcium ATPase 3Add BLAST999

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei1N-acetylmethionine2 Publications1
Modified residuei17PhosphoserineBy similarity1
Modified residuei19PhosphothreonineBy similarity1
Modified residuei25PhosphoserineBy similarity1
Modified residuei415PhosphothreonineBy similarity1
Modified residuei662PhosphoserineCombined sources1

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q93084

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q93084

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q93084

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q93084

PeptideAtlas

More...
PeptideAtlasi
Q93084

PRoteomics IDEntifications database

More...
PRIDEi
Q93084

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
75708 [Q93084-1]
75709 [Q93084-2]
75710 [Q93084-3]
75711 [Q93084-4]
75712 [Q93084-5]
75713 [Q93084-6]
75714 [Q93084-7]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q93084

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q93084

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
Q93084

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Found in most tissues. Most abundant in thymus, trachea, salivary gland, spleen, bone marrow, lymph node, peripheral leukocytes, pancreas and colon. Also detected in fetal tissues. Expressed in cell lineages of hematopoietic, epithelial, or embryonic origin and also expressed in several cancer cell lines.2 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000074370, Expressed in small intestine Peyer's patch and 184 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q93084, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q93084, HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000074370, Tissue enhanced (lymphoid tissue, salivary gland)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with sarcolipin (SLN) (By similarity).

Interacts with phospholamban (PLN) (By similarity).

Interacts with myoregulin (MRLN).

Interacts with DWORF (By similarity). Interacts VMP1 (PubMed:28890335).

By similarity1 Publication

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
106979, 69 interactors

Protein interaction database and analysis system

More...
IntActi
Q93084, 51 interactors

Molecular INTeraction database

More...
MINTi
Q93084

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000353072

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q93084, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q93084

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni370 – 400Interaction with phospholamban 1By similarityAdd BLAST31
Regioni788 – 808Interaction with phospholamban 2By similarityAdd BLAST21

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG0202, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000155668

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_002360_3_2_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q93084

Identification of Orthologs from Complete Genome Data

More...
OMAi
GCCEWWT

Database of Orthologous Groups

More...
OrthoDBi
100699at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q93084

TreeFam database of animal gene trees

More...
TreeFami
TF300651

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
3.40.1110.10, 1 hit
3.40.50.1000, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR006068, ATPase_P-typ_cation-transptr_C
IPR004014, ATPase_P-typ_cation-transptr_N
IPR023299, ATPase_P-typ_cyto_dom_N
IPR018303, ATPase_P-typ_P_site
IPR023298, ATPase_P-typ_TM_dom_sf
IPR008250, ATPase_P-typ_transduc_dom_A_sf
IPR036412, HAD-like_sf
IPR023214, HAD_sf
IPR005782, P-type_ATPase_IIA
IPR001757, P_typ_ATPase
IPR044492, P_typ_ATPase_HD_dom

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00689, Cation_ATPase_C, 1 hit
PF00690, Cation_ATPase_N, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00120, HATPASE

Structure-Function Linkage Database

More...
SFLDi
SFLDF00027, p-type_atpase, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00831, Cation_ATPase_N, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF56784, SSF56784, 1 hit
SSF81653, SSF81653, 1 hit
SSF81660, SSF81660, 1 hit
SSF81665, SSF81665, 1 hit

TIGRFAMs; a protein family database

More...
TIGRFAMsi
TIGR01116, ATPase-IIA1_Ca, 1 hit
TIGR01494, ATPase_P-type, 2 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00154, ATPASE_E1_E2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (7+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 7 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Note: The same names have been attributed to different isoforms.

This entry has 7 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform SERCA3A (identifier: Q93084-2) [UniParc]FASTAAdd to basket
Also known as: HuS3-II

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MEAAHLLPAA DVLRHFSVTA EGGLSPAQVT GARERYGPNE LPSEEGKSLW
60 70 80 90 100
ELVLEQFEDL LVRILLLAAL VSFVLAWFEE GEETTTAFVE PLVIMLILVA
110 120 130 140 150
NAIVGVWQER NAESAIEALK EYEPEMGKVI RSDRKGVQRI RARDIVPGDI
160 170 180 190 200
VEVAVGDKVP ADLRLIEIKS TTLRVDQSIL TGESVSVTKH TEAIPDPRAV
210 220 230 240 250
NQDKKNMLFS GTNITSGKAV GVAVATGLHT ELGKIRSQMA AVEPERTPLQ
260 270 280 290 300
RKLDEFGRQL SHAISVICVA VWVINIGHFA DPAHGGSWLR GAVYYFKIAV
310 320 330 340 350
ALAVAAIPEG LPAVITTCLA LGTRRMARKN AIVRSLPSVE TLGCTSVICS
360 370 380 390 400
DKTGTLTTNQ MSVCRMFVVA EADAGSCLLH EFTISGTTYT PEGEVRQGDQ
410 420 430 440 450
PVRCGQFDGL VELATICALC NDSALDYNEA KGVYEKVGEA TETALTCLVE
460 470 480 490 500
KMNVFDTDLQ ALSRVERAGA CNTVIKQLMR KEFTLEFSRD RKSMSVYCTP
510 520 530 540 550
TRPHPTGQGS KMFVKGAPES VIERCSSVRV GSRTAPLTPT SREQILAKIR
560 570 580 590 600
DWGSGSDTLR CLALATRDAP PRKEDMELDD CSKFVQYETD LTFVGCVGML
610 620 630 640 650
DPPRPEVAAC ITRCYQAGIR VVMITGDNKG TAVAICRRLG IFGDTEDVAG
660 670 680 690 700
KAYTGREFDD LSPEQQRQAC RTARCFARVE PAHKSRIVEN LQSFNEITAM
710 720 730 740 750
TGDGVNDAPA LKKAEIGIAM GSGTAVAKSA AEMVLSDDNF ASIVAAVEEG
760 770 780 790 800
RAIYSNMKQF IRYLISSNVG EVVCIFLTAI LGLPEALIPV QLLWVNLVTD
810 820 830 840 850
GLPATALGFN PPDLDIMEKL PRSPREALIS GWLFFRYLAI GVYVGLATVA
860 870 880 890 900
AATWWFVYDA EGPHINFYQL RNFLKCSEDN PLFAGIDCEV FESRFPTTMA
910 920 930 940 950
LSVLVTIEMC NALNSVSENQ SLLRMPPWMN PWLLVAVAMS MALHFLILLV
960 970 980 990
PPLPLIFQVT PLSGRQWVVV LQISLPVILL DEALKYLSRN HMHEEMSQK
Length:999
Mass (Da):109,256
Last modified:December 2, 2020 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i44E9F1FBF41FE36A
GO
Isoform SERCA3B (identifier: Q93084-1) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     994-999: EEMSQK → ACLYPGLLRTVSQAWSRQPLTTSWTPDHTGRNEPEVSAGNRVESPVCTSD

Show »
Length:1,043
Mass (Da):113,977
Checksum:iCB6514B36E00E091
GO
Isoform SERCA3C (identifier: Q93084-3) [UniParc]FASTAAdd to basket
Also known as: HuS3-IV

The sequence of this isoform differs from the canonical sequence as follows:
     994-998: EEMSQ → ACLYPGLLRTVSQAWSRQPLTTSWTPDHTGLASLK

Show »
Length:1,029
Mass (Da):112,490
Checksum:iF92E6B85AC5BBB81
GO
Isoform SERCA3G (identifier: Q93084-4) [UniParc]FASTAAdd to basket
Also known as: HuS3-I

The sequence of this isoform differs from the canonical sequence as follows:
     994-994: Missing.

Show »
Length:998
Mass (Da):109,127
Checksum:i5C1288D99FE36A3D
GO
Isoform SERCA3E (identifier: Q93084-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     993-993: H → HACLYPGLLRTVSQAWSRQPLTTSWTPDHTGLASLGQGHSIVSLSELLREGGSR

Show »
Length:1,052
Mass (Da):114,931
Checksum:i95DCA1787DEDE2B9
GO
Isoform SERCA3D (identifier: Q93084-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     994-998: EEMSQ → ACLYPGLLRTVSQAWSRQPLTTSWTPDHTGARDTASSRCQSCSEREEAGK

Show »
Length:1,044
Mass (Da):114,131
Checksum:i2D26449A0E4EDC9A
GO
Isoform SERCA3F (identifier: Q93084-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     994-999: EEMSQK → GPGTQHRLAVRAAQRGRKQGRNEPEVSAGNRVESPVCTSD

Show »
Length:1,033
Mass (Da):112,778
Checksum:i02356BCFB8CDA61F
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A0C4DGN1A0A0C4DGN1_HUMAN
Sarcoplasmic/endoplasmic reticulum ...
ATP2A3
142Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0C4DGN3A0A0C4DGN3_HUMAN
Sarcoplasmic/endoplasmic reticulum ...
ATP2A3
153Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti673A → T in AAC24525 (PubMed:9843705).Curated1
Sequence conflicti802L → H in CAA75739 (PubMed:9593748).Curated1
Sequence conflicti817M → I in CAA93737 (PubMed:8809064).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_036498674R → H in a breast cancer sample; somatic mutation. 1 PublicationCorresponds to variant dbSNP:rs144535413Ensembl.1
Natural variantiVAR_048372869Q → H. Corresponds to variant dbSNP:rs11654827Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_060844993H → HACLYPGLLRTVSQAWSRQP LTTSWTPDHTGLASLGQGHS IVSLSELLREGGSR in isoform SERCA3E. Curated1
Alternative sequenceiVSP_060845994 – 999EEMSQK → ACLYPGLLRTVSQAWSRQPL TTSWTPDHTGRNEPEVSAGN RVESPVCTSD in isoform SERCA3B. Curated6
Alternative sequenceiVSP_060846994 – 999EEMSQK → GPGTQHRLAVRAAQRGRKQG RNEPEVSAGNRVESPVCTSD in isoform SERCA3F. Curated6
Alternative sequenceiVSP_060847994 – 998EEMSQ → ACLYPGLLRTVSQAWSRQPL TTSWTPDHTGLASLK in isoform SERCA3C. Curated5
Alternative sequenceiVSP_060848994 – 998EEMSQ → ACLYPGLLRTVSQAWSRQPL TTSWTPDHTGARDTASSRCQ SCSEREEAGK in isoform SERCA3D. Curated5
Alternative sequenceiVSP_060849994Missing in isoform SERCA3G. Curated1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
Z69881 mRNA Translation: CAA93737.1
Z69880 Genomic DNA Translation: CAA93736.1
Y15724 Y15730 Genomic DNA Translation: CAA75739.1
Y15738 Genomic DNA Translation: CAA75748.1
Y15737 Genomic DNA Translation: CAA75747.1
AF068220 mRNA Translation: AAC24525.1
AF068221 mRNA Translation: AAC24526.1
AC005940 Genomic DNA No translation available.
CH471108 Genomic DNA Translation: EAW90468.1
CH471108 Genomic DNA Translation: EAW90463.1
CH471108 Genomic DNA Translation: EAW90469.1
BC035729 mRNA Translation: AAH35729.1
S68239 mRNA Translation: AAB29700.1
AF458228 mRNA Translation: AAL78967.1
AF458229 mRNA Translation: AAL78968.1
AY460339 mRNA Translation: AAR15415.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS11041.1 [Q93084-1]
CCDS11042.1 [Q93084-5]
CCDS42234.1 [Q93084-3]
CCDS45579.1 [Q93084-2]
CCDS45580.1 [Q93084-4]

Protein sequence database of the Protein Information Resource

More...
PIRi
I55399
S72267

NCBI Reference Sequences

More...
RefSeqi
NP_005164.2, NM_005173.3 [Q93084-2]
NP_777613.1, NM_174953.2 [Q93084-5]
NP_777614.1, NM_174954.2 [Q93084-6]
NP_777615.1, NM_174955.2 [Q93084-1]
NP_777616.1, NM_174956.2 [Q93084-3]
NP_777617.1, NM_174957.2 [Q93084-4]
NP_777618.1, NM_174958.2 [Q93084-3]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000309890; ENSP00000312577; ENSG00000074370 [Q93084-3]
ENST00000352011; ENSP00000301387; ENSG00000074370 [Q93084-1]
ENST00000359983; ENSP00000353072; ENSG00000074370 [Q93084-5]
ENST00000397035; ENSP00000380229; ENSG00000074370 [Q93084-3]
ENST00000397041; ENSP00000380234; ENSG00000074370 [Q93084-2]
ENST00000397043; ENSP00000380236; ENSG00000074370 [Q93084-4]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
489

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:489

UCSC genome browser

More...
UCSCi
uc002fwx.3, human [Q93084-2]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
Z69881 mRNA Translation: CAA93737.1
Z69880 Genomic DNA Translation: CAA93736.1
Y15724 Y15730 Genomic DNA Translation: CAA75739.1
Y15738 Genomic DNA Translation: CAA75748.1
Y15737 Genomic DNA Translation: CAA75747.1
AF068220 mRNA Translation: AAC24525.1
AF068221 mRNA Translation: AAC24526.1
AC005940 Genomic DNA No translation available.
CH471108 Genomic DNA Translation: EAW90468.1
CH471108 Genomic DNA Translation: EAW90463.1
CH471108 Genomic DNA Translation: EAW90469.1
BC035729 mRNA Translation: AAH35729.1
S68239 mRNA Translation: AAB29700.1
AF458228 mRNA Translation: AAL78967.1
AF458229 mRNA Translation: AAL78968.1
AY460339 mRNA Translation: AAR15415.1
CCDSiCCDS11041.1 [Q93084-1]
CCDS11042.1 [Q93084-5]
CCDS42234.1 [Q93084-3]
CCDS45579.1 [Q93084-2]
CCDS45580.1 [Q93084-4]
PIRiI55399
S72267
RefSeqiNP_005164.2, NM_005173.3 [Q93084-2]
NP_777613.1, NM_174953.2 [Q93084-5]
NP_777614.1, NM_174954.2 [Q93084-6]
NP_777615.1, NM_174955.2 [Q93084-1]
NP_777616.1, NM_174956.2 [Q93084-3]
NP_777617.1, NM_174957.2 [Q93084-4]
NP_777618.1, NM_174958.2 [Q93084-3]

3D structure databases

SMRiQ93084
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi106979, 69 interactors
IntActiQ93084, 51 interactors
MINTiQ93084
STRINGi9606.ENSP00000353072

Chemistry databases

ChEMBLiCHEMBL2401

PTM databases

iPTMnetiQ93084
PhosphoSitePlusiQ93084
SwissPalmiQ93084

Genetic variation databases

BioMutaiATP2A3
DMDMi19864659

Proteomic databases

jPOSTiQ93084
MassIVEiQ93084
MaxQBiQ93084
PaxDbiQ93084
PeptideAtlasiQ93084
PRIDEiQ93084
ProteomicsDBi75708 [Q93084-1]
75709 [Q93084-2]
75710 [Q93084-3]
75711 [Q93084-4]
75712 [Q93084-5]
75713 [Q93084-6]
75714 [Q93084-7]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
1517, 147 antibodies

The DNASU plasmid repository

More...
DNASUi
489

Genome annotation databases

EnsembliENST00000309890; ENSP00000312577; ENSG00000074370 [Q93084-3]
ENST00000352011; ENSP00000301387; ENSG00000074370 [Q93084-1]
ENST00000359983; ENSP00000353072; ENSG00000074370 [Q93084-5]
ENST00000397035; ENSP00000380229; ENSG00000074370 [Q93084-3]
ENST00000397041; ENSP00000380234; ENSG00000074370 [Q93084-2]
ENST00000397043; ENSP00000380236; ENSG00000074370 [Q93084-4]
GeneIDi489
KEGGihsa:489
UCSCiuc002fwx.3, human [Q93084-2]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
489
DisGeNETi489

GeneCards: human genes, protein and diseases

More...
GeneCardsi
ATP2A3
HGNCiHGNC:813, ATP2A3
HPAiENSG00000074370, Tissue enhanced (lymphoid tissue, salivary gland)
MIMi601929, gene
neXtProtiNX_Q93084
OpenTargetsiENSG00000074370
PharmGKBiPA25106
VEuPathDBiHostDB:ENSG00000074370.17

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG0202, Eukaryota
GeneTreeiENSGT00940000155668
HOGENOMiCLU_002360_3_2_1
InParanoidiQ93084
OMAiGCCEWWT
OrthoDBi100699at2759
PhylomeDBiQ93084
TreeFamiTF300651

Enzyme and pathway databases

PathwayCommonsiQ93084
ReactomeiR-HSA-1912420, Pre-NOTCH Processing in Golgi
R-HSA-418359, Reduction of cytosolic Ca++ levels
R-HSA-5578775, Ion homeostasis
R-HSA-936837, Ion transport by P-type ATPases
SIGNORiQ93084

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
489, 2 hits in 996 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
ATP2A3, human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
ATP2A3

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
489
PharosiQ93084, Tbio

Protein Ontology

More...
PROi
PR:Q93084
RNActiQ93084, protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000074370, Expressed in small intestine Peyer's patch and 184 other tissues
ExpressionAtlasiQ93084, baseline and differential
GenevisibleiQ93084, HS

Family and domain databases

Gene3Di3.40.1110.10, 1 hit
3.40.50.1000, 1 hit
InterProiView protein in InterPro
IPR006068, ATPase_P-typ_cation-transptr_C
IPR004014, ATPase_P-typ_cation-transptr_N
IPR023299, ATPase_P-typ_cyto_dom_N
IPR018303, ATPase_P-typ_P_site
IPR023298, ATPase_P-typ_TM_dom_sf
IPR008250, ATPase_P-typ_transduc_dom_A_sf
IPR036412, HAD-like_sf
IPR023214, HAD_sf
IPR005782, P-type_ATPase_IIA
IPR001757, P_typ_ATPase
IPR044492, P_typ_ATPase_HD_dom
PfamiView protein in Pfam
PF00689, Cation_ATPase_C, 1 hit
PF00690, Cation_ATPase_N, 1 hit
PRINTSiPR00120, HATPASE
SFLDiSFLDF00027, p-type_atpase, 1 hit
SMARTiView protein in SMART
SM00831, Cation_ATPase_N, 1 hit
SUPFAMiSSF56784, SSF56784, 1 hit
SSF81653, SSF81653, 1 hit
SSF81660, SSF81660, 1 hit
SSF81665, SSF81665, 1 hit
TIGRFAMsiTIGR01116, ATPase-IIA1_Ca, 1 hit
TIGR01494, ATPase_P-type, 2 hits
PROSITEiView protein in PROSITE
PS00154, ATPASE_E1_E2, 1 hit

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiAT2A3_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q93084
Secondary accession number(s): A8MZG0
, D3DTJ8, O60900, O60901, O75501, O75502, Q16115, Q6JHX1, Q8TEX5, Q8TEX6
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: December 2, 2020
Last modified: June 2, 2021
This is version 206 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 17
    Human chromosome 17: entries, gene names and cross-references to MIM
  2. Human entries with genetic variants
    List of human entries with genetic variants
  3. Human variants curated from literature reports
    Index of human variants curated from literature reports
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again