Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 188 (17 Jun 2020)
Sequence version 1 (01 Feb 1997)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

RNA-binding protein with multiple splicing

Gene

RBPMS

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Acts as a coactivator of transcriptional activity. Required to increase TGFB1/Smad-mediated transactivation. Acts through SMAD2, SMAD3 and SMAD4 to increase transcriptional activity. Increases phosphorylation of SMAD2 and SMAD3 on their C-terminal SSXS motif, possibly through recruitment of TGFBR1. Promotes the nuclear accumulation of SMAD2, SMAD3 and SMAD4 proteins (PubMed:26347403). Binds to poly(A) RNA (PubMed:17099224, PubMed:26347403).2 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionActivator, RNA-binding
Biological processTranscription, Transcription regulation

Protein family/group databases

MoonDB Database of extreme multifunctional and moonlighting proteins

More...
MoonDBi
Q93062 Predicted

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
RNA-binding protein with multiple splicing
Short name:
RBP-MS
Alternative name(s):
Heart and RRM expressed sequence
Short name:
Hermes
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:RBPMS
Synonyms:HERMES
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 8

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000157110.15

Human Gene Nomenclature Database

More...
HGNCi
HGNC:19097 RBPMS

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
601558 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q93062

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology%5Fand%5Fbiotech%5Fsection">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi27F → A: Abolishes RNA binding. 1 Publication1
Mutagenesisi36 – 38KPR → EPE: Impairs dimerization and RNA binding. 1 Publication3
Mutagenesisi65F → A: Abolishes RNA binding. 1 Publication1
Mutagenesisi97E → A: Abolishes RNA binding; when associated with A-100. 1 Publication1
Mutagenesisi100K → A: Abolishes RNA binding; when associated with A-97. 1 Publication1
Mutagenesisi100K → E: Abolishes RNA binding. 1 Publication1
Mutagenesisi103 – 104TK → AA: Abolishes RNA binding. 1 Publication2

Organism-specific databases

DisGeNET

More...
DisGeNETi
11030

Open Targets

More...
OpenTargetsi
ENSG00000157110

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA134985584

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q93062 Tbio

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
RBPMS

Domain mapping of disease mutations (DMDM)

More...
DMDMi
13124469

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000817931 – 196RNA-binding protein with multiple splicingAdd BLAST196

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei1N-acetylmethionineCombined sources1
Modified residuei12PhosphothreonineBy similarity1
Modified residuei113PhosphothreonineCombined sources1

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q93062

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q93062

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q93062

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q93062

PeptideAtlas

More...
PeptideAtlasi
Q93062

PRoteomics IDEntifications database

More...
PRIDEi
Q93062

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
75691 [Q93062-1]
75692 [Q93062-2]
75693 [Q93062-3]
75694 [Q93062-4]
75695 [Q93062-5]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q93062

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q93062

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Ubiquitously expressed, at various levels depending on the isoform and the tissue.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000157110 Expressed in lower esophagus muscularis layer and 221 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q93062 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q93062 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000157110 Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Homodimer; each protein chain binds one RNA molecule via the external surface of the homodimer (PubMed:26347403).

Interacts with SMAD2, SMAD3 and SMAD4; the interactions are direct (PubMed:17099224).

2 Publications

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection describes interesting single amino acid sites on the sequence that are not defined in any other subsection. This subsection can be displayed in different sections ('Function', 'PTM / Processing', 'Pathology and Biotech') according to its content.<p><a href='/help/site' target='_top'>More...</a></p>Sitei27Interaction with RNA1 Publication1
Sitei61Interaction with RNA1 Publication1

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Q93062
With#Exp.IntAct
ADAM15 [Q13444]3EBI-740322,EBI-77818
AMMECR1 [Q9Y4X0]4EBI-740322,EBI-8583355
ATXN1 [P54253]6EBI-740322,EBI-930964
BANP [Q8N9N5]3EBI-740322,EBI-744695
BBS2 [Q9BXC9]3EBI-740322,EBI-748297
BCL6B [A8KA13]3EBI-740322,EBI-10174813
BHLHE40 [O14503]3EBI-740322,EBI-711810
BOLL [Q8N9W6]3EBI-740322,EBI-998198
C11orf87 [Q6NUJ2]3EBI-740322,EBI-6660291
C1orf94 [Q6P1W5]4EBI-740322,EBI-946029
C22orf39 [Q6P5X5]3EBI-740322,EBI-7317823
CAMK2B [Q13554]3EBI-740322,EBI-1058722
CCNG1 [P51959]3EBI-740322,EBI-3905829
CCNK [O75909]4EBI-740322,EBI-739806
CDC23 [Q9UJX2]4EBI-740322,EBI-396137
CRBN [Q96SW2]3EBI-740322,EBI-2510250
CREB5 - isoform 3 [Q02930-3]3EBI-740322,EBI-10192698
CRYBA1 [P05813]3EBI-740322,EBI-7043337
CSN3 [P07498]4EBI-740322,EBI-2602175
DAZAP2 [Q15038]6EBI-740322,EBI-724310
DCAF8 [Q5TAQ9]3EBI-740322,EBI-740686
DCDC2B [A2VCK2]3EBI-740322,EBI-10173222
DCTN5 [Q9BTE1]3EBI-740322,EBI-747324
DMRT3 [Q9NQL9]3EBI-740322,EBI-9679045
DOK3 [Q7L591]3EBI-740322,EBI-2834978
DOK6 [Q6PKX4]3EBI-740322,EBI-2880244
DPYSL4 [O14531]3EBI-740322,EBI-719542
DTX2 [Q86UW9]7EBI-740322,EBI-740376
EFEMP2 [O95967]3EBI-740322,EBI-743414
FAM124B [Q9H5Z6]3EBI-740322,EBI-741626
FAM168A [Q92567]5EBI-740322,EBI-7957930
FBF1 - isoform 6 [Q8TES7-6]3EBI-740322,EBI-10244131
FBXL18 [Q96D16]3EBI-740322,EBI-744419
FNDC11 [Q9BVV2]3EBI-740322,EBI-744935
FOXC2 [Q99958]3EBI-740322,EBI-3956892
FOXP3 [Q9BZS1]6EBI-740322,EBI-983719
GCM2 [O75603]5EBI-740322,EBI-10188645
GLYCTK [Q8IVS8]3EBI-740322,EBI-748515
GPATCH2L [Q9NWQ4]3EBI-740322,EBI-5666657
GPS2 [Q13227]3EBI-740322,EBI-713355
GRAP [Q13588]3EBI-740322,EBI-2847510
GSE1 [Q14687]3EBI-740322,EBI-372619
hCG_20425 [B4DNA4]3EBI-740322,EBI-7399002
HEY2 [Q9UBP5]3EBI-740322,EBI-750630
HEYL [Q9NQ87]4EBI-740322,EBI-751092
HNRNPLL [Q8WVV9]3EBI-740322,EBI-535849
HOXA1 [P49639]3EBI-740322,EBI-740785
IGF2 [P01344]3EBI-740322,EBI-7178764
ILF3 [Q9NXX0]3EBI-740322,EBI-743980
INCA1 [Q0VD86]3EBI-740322,EBI-6509505
INIP [Q9NRY2]4EBI-740322,EBI-2881520
IP6K2 [Q9UHH9]3EBI-740322,EBI-747509
KCTD9 [Q7L273]3EBI-740322,EBI-4397613
KIAA1305 [Q96HR4]3EBI-740322,EBI-10288524
KIR2DL4 [Q99706]3EBI-740322,EBI-10294579
KPNA2 [P52292]3EBI-740322,EBI-349938
KRTAP12-2 [P59991]3EBI-740322,EBI-10176379
KRTAP19-5 [Q3LI72]4EBI-740322,EBI-1048945
KRTAP19-7 [Q3SYF9]3EBI-740322,EBI-10241353
KRTAP23-1 [A1A580]3EBI-740322,EBI-10171734
KRTAP8-1 [Q8IUC2]3EBI-740322,EBI-10261141
LGALS9C [Q6DKI2]3EBI-740322,EBI-9088829
LINC00482 [Q8N8I6]3EBI-740322,EBI-10267998
LINC00588 [Q9Y4M8]3EBI-740322,EBI-10039207
LMO4 [P61968]3EBI-740322,EBI-2798728
LONRF1 [Q17RB8]3EBI-740322,EBI-2341787
MAGED1 [Q9Y5V3]3EBI-740322,EBI-716006
MCM5 [B1AHB0]3EBI-740322,EBI-10175425
MYOZ2 [Q9NPC6]3EBI-740322,EBI-746712
NAPRT [Q6XQN6]3EBI-740322,EBI-10254872
NAPRT - isoform 2 [Q6XQN6-2]3EBI-740322,EBI-10254820
NEDD9 [Q14511]3EBI-740322,EBI-2108053
NR1D2 [Q6NSM0]4EBI-740322,EBI-10250949
OTX1 [P32242]4EBI-740322,EBI-740446
PER1 [J3QSH9]3EBI-740322,EBI-10178671
PER1 [Q6IN51]3EBI-740322,EBI-10250187
PHF1 [O43189]4EBI-740322,EBI-530034
PIH1D1 [Q9NWS0]3EBI-740322,EBI-357318
PIN1 [Q13526]4EBI-740322,EBI-714158
PITX1 [P78337]6EBI-740322,EBI-748265
POGZ [Q7Z3K3]3EBI-740322,EBI-1389308
POM121 [Q96HA1]4EBI-740322,EBI-739990
PP9974 [P09565]3EBI-740322,EBI-10196507
PRKAA1 [Q13131]3EBI-740322,EBI-1181405
PRKAA2 [P54646]3EBI-740322,EBI-1383852
PRR20C [P86479]3EBI-740322,EBI-10172814
QKI [Q96PU8]5EBI-740322,EBI-945792
R3HDM2 - isoform 2 [Q9Y2K5-2]3EBI-740322,EBI-10326419
RBFOX1 [Q9NWB1]3EBI-740322,EBI-945906
RDH12 [Q96NR8]3EBI-740322,EBI-3916363
RHOBTB3 [O94955]4EBI-740322,EBI-2367123
RHOXF2 [Q9BQY4]6EBI-740322,EBI-372094
RIPPLY1 [Q0D2K3]3EBI-740322,EBI-10226430
ROR2 [A1L4F5]3EBI-740322,EBI-10172778
RTP5 [Q14D33]3EBI-740322,EBI-10217913
RUSC1 [Q9BVN2]4EBI-740322,EBI-6257312
SBF2 [Q86WG5]3EBI-740322,EBI-2683289
SEMA4G - isoform 3 [Q9NTN9-3]3EBI-740322,EBI-9089805
SH3RF2 [Q08AM8]3EBI-740322,EBI-10225873
SIRPB1 - isoform 2 [O00241-2]3EBI-740322,EBI-10179231
SMRP1 [Q8NCR6]3EBI-740322,EBI-10269322
SMUG1 [Q53HV7]2EBI-740322,EBI-749970
SNRPB - isoform SM-B [P14678-2]3EBI-740322,EBI-372475
SNRPC [Q5TAL4]3EBI-740322,EBI-10246938
SPATA46 [Q5T0L3]3EBI-740322,EBI-750105
SPATA8 [Q6RVD6]4EBI-740322,EBI-8635958
SPG7 [Q9UQ90]3EBI-740322,EBI-717201
STRBP [Q96SI9]4EBI-740322,EBI-740355
TBX6 [O95947]3EBI-740322,EBI-2824328
TENT2 [Q6PIY7]3EBI-740322,EBI-2802204
TEX37 [Q96LM6]4EBI-740322,EBI-743976
TFG [Q92734]3EBI-740322,EBI-357061
TIE1 [P35590]3EBI-740322,EBI-2256865
TINAGL1 - isoform 3 [Q9GZM7-3]3EBI-740322,EBI-10303636
TLE5 [Q08117]3EBI-740322,EBI-717810
TMSB4X [Q0P5Q0]3EBI-740322,EBI-10226570
TOLLIP [Q6FIE9]3EBI-740322,EBI-10249783
TOLLIP [Q9H0E2]4EBI-740322,EBI-74615
TOR1AIP2 [Q9H496]3EBI-740322,EBI-2510146
TTLL10 [Q6ZVT0]3EBI-740322,EBI-7844656
TUSC2 [O75896]4EBI-740322,EBI-1052725
VENTX [O95231]4EBI-740322,EBI-10191303
VHLL [Q6RSH7]3EBI-740322,EBI-10254232
VPS37C [A5D8V6]3EBI-740322,EBI-2559305
WDR90 [Q96KV7]3EBI-740322,EBI-9478492
WDYHV1 [Q96HA8]3EBI-740322,EBI-741158
ZBTB32 [A0A0C4DGF1]5EBI-740322,EBI-10188476
ZC3H10 [Q96K80]4EBI-740322,EBI-742550
ZNF385C [Q66K41]3EBI-740322,EBI-8651919
ZNF488 [Q96MN9]4EBI-740322,EBI-948288
ZNF581 [Q9P0T4]4EBI-740322,EBI-745520
B2R5503EBI-740322,EBI-10175488
Q96EJ43EBI-740322,EBI-750454
Hoxa1 [P09022] from Mus musculus.3EBI-740322,EBI-3957603
Isoform C [Q93062-3]
With#Exp.IntAct
ABCF3 [A0A0S2Z645]3EBI-740343,EBI-16432404
ANAPC11 - isoform 2 [Q9NYG5-2]3EBI-740343,EBI-12224467
ANKMY1 [A0A0S2Z596]3EBI-740343,EBI-16433724
ARID5A [Q03989]3EBI-740343,EBI-948603
ATXN1 [P54253]3EBI-740343,EBI-930964
C10orf55 [Q5SWW7]3EBI-740343,EBI-12809220
C11orf87 [Q6NUJ2]3EBI-740343,EBI-6660291
C19orf54 - isoform 3 [Q5BKX5-3]3EBI-740343,EBI-11976299
C20orf85 [Q9H1P6]3EBI-740343,EBI-12155483
CAMK2A [Q9UQM7]3EBI-740343,EBI-1383687
CCDC120 [Q96HB5]3EBI-740343,EBI-744556
CLPP [Q16740]3EBI-740343,EBI-1056029
CNNM3 [Q8NE01]3EBI-740343,EBI-741032
COL8A1 [P27658]3EBI-740343,EBI-747133
CREB5 - isoform 3 [Q02930-3]3EBI-740343,EBI-10192698
DAZAP2 [Q15038]7EBI-740343,EBI-724310
FAM166B - isoform 2 [A8MTA8-2]6EBI-740343,EBI-12160437
FAM168A - isoform 2 [Q92567-2]3EBI-740343,EBI-11978259
FOXP3 [Q9BZS1]3EBI-740343,EBI-983719
GATA2 [P23769]3EBI-740343,EBI-2806671
GCM2 [O75603]3EBI-740343,EBI-10188645
GLIS2 [Q9BZE0]3EBI-740343,EBI-7251368
HCK - isoform 2 [P08631-2]3EBI-740343,EBI-9834454
INCA1 [Q0VD86]3EBI-740343,EBI-6509505
KLHDC7B [Q96G42]3EBI-740343,EBI-9478422
KRTAP11-1 [Q8IUC1]3EBI-740343,EBI-1052037
KRTAP12-1 [P59990]3EBI-740343,EBI-10210845
KRTAP12-4 [P60329]3EBI-740343,EBI-10176396
KRTAP13-3 [Q3SY46]3EBI-740343,EBI-10241252
KRTAP15-1 [Q3LI76]6EBI-740343,EBI-11992140
KRTAP19-1 [Q8IUB9]3EBI-740343,EBI-12811111
KRTAP19-3 [Q7Z4W3]3EBI-740343,EBI-12020132
KRTAP19-5 [Q3LI72]6EBI-740343,EBI-1048945
KRTAP19-7 [Q3SYF9]6EBI-740343,EBI-10241353
KRTAP26-1 [Q6PEX3]3EBI-740343,EBI-3957672
KRTAP3-1 [Q9BYR8]3EBI-740343,EBI-9996449
LASP1 - isoform 2 [Q14847-2]8EBI-740343,EBI-9088686
MLLT10 - isoform 2 [P55197-2]3EBI-740343,EBI-12853322
MSX1 [P28360]3EBI-740343,EBI-3919342
MYH7B - isoform 2 [A7E2Y1-2]3EBI-740343,EBI-12813813
NKX2-5 [P52952]3EBI-740343,EBI-936601
PATZ1 - isoform 4 [Q9HBE1-4]6EBI-740343,EBI-11022007
PHF1 [O43189]3EBI-740343,EBI-530034
PITX1 [P78337]4EBI-740343,EBI-748265
PITX2 - isoform PTX2C [Q99697-2]3EBI-740343,EBI-12138495
PLSCR4 [Q9NRQ2]3EBI-740343,EBI-769257
POGZ [Q7Z3K3]5EBI-740343,EBI-1389308
POU4F2 [Q12837]3EBI-740343,EBI-17236143
POU6F2 [P78424]3EBI-740343,EBI-12029004
PRKAB2 [O43741]3EBI-740343,EBI-1053424
PRR20D [P86480]3EBI-740343,EBI-12754095
PRR35 [P0CG20]3EBI-740343,EBI-11986293
PSG11 [A0A024R0L9]3EBI-740343,EBI-10696468
RAD54L2 [Q9Y4B4]3EBI-740343,EBI-948156
RBFOX1 - isoform 5 [Q9NWB1-5]4EBI-740343,EBI-12123390
RBFOX2 - isoform 10 [O43251-10]3EBI-740343,EBI-11963050
RBM24 - isoform 2 [Q9BX46-2]3EBI-740343,EBI-12224445
RBPMS2 [Q6ZRY4]3EBI-740343,EBI-11987469
RDH12 [Q96NR8]3EBI-740343,EBI-3916363
RHOXF2 [Q9BQY4]3EBI-740343,EBI-372094
RPP25 [Q9BUL9]3EBI-740343,EBI-366570
RUSC1 [Q9BVN2]3EBI-740343,EBI-6257312
SLC25A48 - isoform 3 [Q6ZT89-3]3EBI-740343,EBI-12065614
SMAP1 - isoform 2 [Q8IYB5-2]3EBI-740343,EBI-12061577
SMUG1 - isoform 2 [Q53HV7-2]6EBI-740343,EBI-12275818
SNRPC [P09234]3EBI-740343,EBI-766589
STRBP [A0A0S2Z5K8]3EBI-740343,EBI-16433759
STRBP [Q96SI9]3EBI-740343,EBI-740355
TBX6 [O95947]4EBI-740343,EBI-2824328
TCEA2 [Q15560]3EBI-740343,EBI-710310
TEKT5 [Q96M29]3EBI-740343,EBI-10239812
TEX37 [Q96LM6]3EBI-740343,EBI-743976
TLE5 - isoform 2 [Q08117-2]5EBI-740343,EBI-11741437
TMEM42 [Q69YG0]3EBI-740343,EBI-12038591
TSC1 [Q86WV8]3EBI-740343,EBI-12806590
TSGA10IP [Q3SY00]3EBI-740343,EBI-10241197
TSPYL6 [Q8N831]3EBI-740343,EBI-12023322
UBAP2 [Q5T6F2]3EBI-740343,EBI-2514383
VEZF1 [Q14119]3EBI-740343,EBI-11980193
VGLL3 - isoform 2 [A8MV65-2]3EBI-740343,EBI-11957216
VHLL [Q6RSH7]3EBI-740343,EBI-10254232
VPS37C [A5D8V6]3EBI-740343,EBI-2559305
ZBTB32 [A0A0C4DGF1]7EBI-740343,EBI-10188476
ZIC1 [Q15915]3EBI-740343,EBI-11963196
ZNF581 [Q9P0T4]8EBI-740343,EBI-745520

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
116220, 238 interactors

Protein interaction database and analysis system

More...
IntActi
Q93062, 276 interactors

Molecular INTeraction database

More...
MINTi
Q93062

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000340176

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q93062 protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1196
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q93062

Database of comparative protein structure models

More...
ModBasei
Search...

Protein Data Bank in Europe - Knowledge Base

More...
PDBe-KBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini24 – 101RRMPROSITE-ProRule annotationAdd BLAST78

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni98 – 105Interaction with RNA1 Publication8

<p>This subsection of the 'Family and domains' section provides general information on the biological role of a domain. The term 'domain' is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The RRM domain is necessary for interaction with SMAD4. Both the RRM domain and the C-terminus are required for TGFB1/Smad-mediated transactivation activity.

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1457 Eukaryota
ENOG410XSBT LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000159617

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_099973_1_1_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q93062

Identification of Orthologs from Complete Genome Data

More...
OMAi
FIAREPX

Database of Orthologous Groups

More...
OrthoDBi
1368991at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q93062

TreeFam database of animal gene trees

More...
TreeFami
TF351070

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
3.30.70.330, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR012677 Nucleotide-bd_a/b_plait_sf
IPR035979 RBD_domain_sf
IPR000504 RRM_dom

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00076 RRM_1, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00360 RRM, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF54928 SSF54928, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50102 RRM, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 5 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Note: Additional isoforms seem to exist.

This entry has 5 described isoforms and 6 potential isoforms that are computationally mapped.Show allAlign All

Isoform A (identifier: Q93062-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MNNGGKAEKE NTPSEANLQE EEVRTLFVSG LPLDIKPREL YLLFRPFKGY
60 70 80 90 100
EGSLIKLTSK QPVGFVSFDS RSEAEAAKNA LNGIRFDPEI PQTLRLEFAK
110 120 130 140 150
ANTKMAKNKL VGTPNPSTPL PNTVPQFIAR EPYELTVPAL YPSSPEVWAP
160 170 180 190
YPLYPAELAP ALPPPAFTYP ASLHAQMRWL PPSEATSQGW KSRQFC
Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Length:196
Mass (Da):21,802
Last modified:February 1, 1997 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i05DD964E62F8F88C
GO
Isoform B (identifier: Q93062-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     177-196: MRWLPPSEATSQGWKSRQFC → LCEGQTVRRSHPLSAPSPDSASLAWFPV

Show »
Length:204
Mass (Da):22,416
Checksum:i60382A7EC1D4672F
GO
Isoform C (identifier: Q93062-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     177-196: MRWLPPSEATSQGWKSRQFC → CFSPEAKPNTPVFCPLLQQIRFVSGNVFVTYQPTADQQRELPC

Show »
Length:219
Mass (Da):24,277
Checksum:i700E9B9FA7682FAD
GO
Isoform D (identifier: Q93062-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     133-196: YELTVPALYPSSPEVWAPYPLYPAELAPALPPPAFTYPASLHAQMRWLPPSEATSQGWKSRQFC → LGGANEHGERQ

Show »
Length:143
Mass (Da):15,794
Checksum:i86DDB14345784716
GO
Isoform E (identifier: Q93062-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     133-176: Missing.

Show »
Length:152
Mass (Da):17,022
Checksum:iB62DC25BB6EFB888
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 6 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
B4E3T4B4E3T4_HUMAN
HCG2043421, isoform CRA_c
RBPMS hCG_2043421
224Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E5RJ31E5RJ31_HUMAN
RNA-binding protein with multiple-s...
RBPMS
120Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E5RJD7E5RJD7_HUMAN
RNA-binding protein with multiple-s...
RBPMS
49Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E5RFP4E5RFP4_HUMAN
RNA-binding protein with multiple-s...
RBPMS
115Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YBU9H0YBU9_HUMAN
RNA-binding protein with multiple-s...
RBPMS
119Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YC46H0YC46_HUMAN
RNA-binding protein with multiple-s...
RBPMS
113Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_005815133 – 196YELTV…SRQFC → LGGANEHGERQ in isoform D. 1 PublicationAdd BLAST64
Alternative sequenceiVSP_005816133 – 176Missing in isoform E. 1 PublicationAdd BLAST44
Alternative sequenceiVSP_005813177 – 196MRWLP…SRQFC → LCEGQTVRRSHPLSAPSPDS ASLAWFPV in isoform B. 1 PublicationAdd BLAST20
Alternative sequenceiVSP_005814177 – 196MRWLP…SRQFC → CFSPEAKPNTPVFCPLLQQI RFVSGNVFVTYQPTADQQRE LPC in isoform C. 2 PublicationsAdd BLAST20

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
D84110 mRNA Translation: BAA12228.1
D84107 mRNA Translation: BAA12225.1
D84108 mRNA Translation: BAA12226.1
D84109 mRNA Translation: BAA12227.1
D84111 mRNA Translation: BAA12229.1
CH471080 Genomic DNA Translation: EAW63451.1
CH471080 Genomic DNA Translation: EAW63453.1
BC003608 mRNA Translation: AAH03608.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS34875.1 [Q93062-2]
CCDS34876.1 [Q93062-3]
CCDS6077.1 [Q93062-1]

Protein sequence database of the Protein Information Resource

More...
PIRi
JC6127

NCBI Reference Sequences

More...
RefSeqi
NP_001008710.1, NM_001008710.2 [Q93062-1]
NP_001008711.1, NM_001008711.2 [Q93062-2]
NP_001008712.1, NM_001008712.2 [Q93062-3]
NP_006858.1, NM_006867.3 [Q93062-1]
XP_016868475.1, XM_017012986.1 [Q93062-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000287771; ENSP00000287771; ENSG00000157110 [Q93062-2]
ENST00000320203; ENSP00000318102; ENSG00000157110 [Q93062-1]
ENST00000339877; ENSP00000340176; ENSG00000157110 [Q93062-3]
ENST00000397323; ENSP00000380486; ENSG00000157110 [Q93062-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
11030

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:11030

UCSC genome browser

More...
UCSCi
uc003xib.5 human [Q93062-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D84110 mRNA Translation: BAA12228.1
D84107 mRNA Translation: BAA12225.1
D84108 mRNA Translation: BAA12226.1
D84109 mRNA Translation: BAA12227.1
D84111 mRNA Translation: BAA12229.1
CH471080 Genomic DNA Translation: EAW63451.1
CH471080 Genomic DNA Translation: EAW63453.1
BC003608 mRNA Translation: AAH03608.1
CCDSiCCDS34875.1 [Q93062-2]
CCDS34876.1 [Q93062-3]
CCDS6077.1 [Q93062-1]
PIRiJC6127
RefSeqiNP_001008710.1, NM_001008710.2 [Q93062-1]
NP_001008711.1, NM_001008711.2 [Q93062-2]
NP_001008712.1, NM_001008712.2 [Q93062-3]
NP_006858.1, NM_006867.3 [Q93062-1]
XP_016868475.1, XM_017012986.1 [Q93062-1]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1BNYmodel-A15-111[»]
5CYJX-ray1.79A/B14-111[»]
5DETX-ray1.95A/B14-111[»]
SMRiQ93062
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGRIDi116220, 238 interactors
IntActiQ93062, 276 interactors
MINTiQ93062
STRINGi9606.ENSP00000340176

Protein family/group databases

MoonDBiQ93062 Predicted

PTM databases

iPTMnetiQ93062
PhosphoSitePlusiQ93062

Polymorphism and mutation databases

BioMutaiRBPMS
DMDMi13124469

Proteomic databases

jPOSTiQ93062
MassIVEiQ93062
MaxQBiQ93062
PaxDbiQ93062
PeptideAtlasiQ93062
PRIDEiQ93062
ProteomicsDBi75691 [Q93062-1]
75692 [Q93062-2]
75693 [Q93062-3]
75694 [Q93062-4]
75695 [Q93062-5]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
23209 422 antibodies

Genome annotation databases

EnsembliENST00000287771; ENSP00000287771; ENSG00000157110 [Q93062-2]
ENST00000320203; ENSP00000318102; ENSG00000157110 [Q93062-1]
ENST00000339877; ENSP00000340176; ENSG00000157110 [Q93062-3]
ENST00000397323; ENSP00000380486; ENSG00000157110 [Q93062-1]
GeneIDi11030
KEGGihsa:11030
UCSCiuc003xib.5 human [Q93062-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
11030
DisGeNETi11030
EuPathDBiHostDB:ENSG00000157110.15

GeneCards: human genes, protein and diseases

More...
GeneCardsi
RBPMS
HGNCiHGNC:19097 RBPMS
HPAiENSG00000157110 Low tissue specificity
MIMi601558 gene
neXtProtiNX_Q93062
OpenTargetsiENSG00000157110
PharmGKBiPA134985584

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG1457 Eukaryota
ENOG410XSBT LUCA
GeneTreeiENSGT00940000159617
HOGENOMiCLU_099973_1_1_1
InParanoidiQ93062
OMAiFIAREPX
OrthoDBi1368991at2759
PhylomeDBiQ93062
TreeFamiTF351070

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
11030 1 hit in 790 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
RBPMS human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
RBPMS

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
11030
PharosiQ93062 Tbio

Protein Ontology

More...
PROi
PR:Q93062
RNActiQ93062 protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000157110 Expressed in lower esophagus muscularis layer and 221 other tissues
ExpressionAtlasiQ93062 baseline and differential
GenevisibleiQ93062 HS

Family and domain databases

Gene3Di3.30.70.330, 1 hit
InterProiView protein in InterPro
IPR012677 Nucleotide-bd_a/b_plait_sf
IPR035979 RBD_domain_sf
IPR000504 RRM_dom
PfamiView protein in Pfam
PF00076 RRM_1, 1 hit
SMARTiView protein in SMART
SM00360 RRM, 1 hit
SUPFAMiSSF54928 SSF54928, 1 hit
PROSITEiView protein in PROSITE
PS50102 RRM, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiRBPMS_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q93062
Secondary accession number(s): D3DSU9
, Q92516, Q92517, Q92518, Q96J26
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 21, 2001
Last sequence update: February 1, 1997
Last modified: June 17, 2020
This is version 188 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. Human chromosome 8
    Human chromosome 8: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again