Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - Q93038 (TNR25_HUMAN)

Entry version 180 (16 Jan 2019)
Sequence version 2 (01 Nov 1997)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Tumor necrosis factor receptor superfamily member 25

Gene

TNFRSF25

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Receptor for TNFSF12/APO3L/TWEAK. Interacts directly with the adapter TRADD. Mediates activation of NF-kappa-B and induces apoptosis. May play a role in regulating lymphocyte homeostasis.

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • signaling receptor activity Source: UniProtKB
  • tumor necrosis factor-activated receptor activity Source: ProtInc
View the complete GO annotation on QuickGO ...

GO - Biological processi

View the complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionReceptor
Biological processApoptosis

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-5669034 TNFs bind their physiological receptors

SIGNOR Signaling Network Open Resource

More...SIGNORi		Q93038

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Tumor necrosis factor receptor superfamily member 25
Alternative name(s):
Apo-3
Apoptosis-inducing receptor AIR
Apoptosis-mediating receptor DR3
Apoptosis-mediating receptor TRAMP
Death receptor 3
Lymphocyte-associated receptor of death
Short name:
LARD
Protein WSL
Protein WSL-1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:TNFRSF25
Synonyms:APO3, DDR3, DR3, TNFRSF12, WSL, WSL1
ORF Names:UNQ455/PRO779
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 1

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...EuPathDBi		HostDB:ENSG00000215788.9

Human Gene Nomenclature Database

More...HGNCi		HGNC:11910 TNFRSF25

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		603366 gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_Q93038

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini25 – 199ExtracellularSequence analysisAdd BLAST175
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei200 – 220HelicalSequence analysisAdd BLAST21
Topological domaini221 – 417CytoplasmicSequence analysisAdd BLAST197

Keywords - Cellular componenti

Cell membrane, Membrane, Secreted

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi354L → A: Suppresses homodimerization, TNFR1 interaction, and apoptosis induction. 1 Publication1
Mutagenesisi356L → A: Suppresses homodimerization, and TNFR1 interaction. 1 Publication1
Mutagenesisi373D → A: Suppresses homodimerization, and TNFR1 interaction. 1 Publication1

Organism-specific databases

DisGeNET

More...DisGeNETi		8718

Open Targets

More...OpenTargetsi		ENSG00000215788

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA36603

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		TNFRSF25

Domain mapping of disease mutations (DMDM)

More...DMDMi		2501233

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 24Sequence analysisAdd BLAST24
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000003460625 – 417Tumor necrosis factor receptor superfamily member 25Add BLAST393

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi35 ↔ 47PROSITE-ProRule annotation
Disulfide bondi48 ↔ 61PROSITE-ProRule annotation
Disulfide bondi51 ↔ 70PROSITE-ProRule annotation
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi67N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi73 ↔ 89PROSITE-ProRule annotation
Disulfide bondi92 ↔ 107PROSITE-ProRule annotation
Disulfide bondi95 ↔ 115PROSITE-ProRule annotation
Glycosylationi106N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi117 ↔ 130PROSITE-ProRule annotation
Disulfide bondi138 ↔ 155PROSITE-ProRule annotation
Disulfide bondi141 ↔ 162PROSITE-ProRule annotation
Disulfide bondi165 ↔ 176PROSITE-ProRule annotation
Disulfide bondi179 ↔ 191PROSITE-ProRule annotation
Disulfide bondi187 ↔ 195PROSITE-ProRule annotation

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Glycosylated.Curated

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		Q93038

PeptideAtlas

More...PeptideAtlasi		Q93038

PRoteomics IDEntifications database

More...PRIDEi		Q93038

ProteomicsDB human proteome resource

More...ProteomicsDBi		75674
75675 [Q93038-10]
75676 [Q93038-11]
75677 [Q93038-12]
75678 [Q93038-2]
75679 [Q93038-3]
75680 [Q93038-4]
75681 [Q93038-5]
75682 [Q93038-6]
75683 [Q93038-7]
75684 [Q93038-8]
75685 [Q93038-9]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q93038

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Abundantly expressed in thymocytes and lymphocytes. Detected in lymphocyte-rich tissues such as thymus, colon, intestine, and spleen. Also found in the prostate.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000215788 Expressed in 180 organ(s), highest expression level in right hemisphere of cerebellum

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		Q93038 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q93038 HS

Organism-specific databases

Human Protein Atlas

More...HPAi		HPA069834

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Homodimer. Interacts strongly via the death domains with TNFRSF1 and TRADD to activate at least two distinct signaling cascades, apoptosis and NF-kappa-B signaling. Interacts with BAG4.1 Publication

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...BioGridi		114258, 11 interactors

Database of interacting proteins

More...DIPi		DIP-59563N

Protein interaction database and analysis system

More...IntActi		Q93038, 1 interactor

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...ProteinModelPortali		Q93038

Database of comparative protein structure models

More...ModBasei		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati34 – 71TNFR-Cys 1Add BLAST38
Repeati72 – 115TNFR-Cys 2Add BLAST44
Repeati116 – 163TNFR-Cys 3Add BLAST48
Repeati164 – 192TNFR-Cys 4Add BLAST29
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini332 – 413DeathPROSITE-ProRule annotationAdd BLAST82

Keywords - Domaini

Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

Ensembl GeneTree

More...GeneTreei		ENSGT00940000161888

The HOVERGEN Database of Homologous Vertebrate Genes

More...HOVERGENi		HBG058493

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q93038

KEGG Orthology (KO)

More...KOi		K05160

Identification of Orthologs from Complete Genome Data

More...OMAi		RALHRHT

Database of Orthologous Groups

More...OrthoDBi		726174at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q93038

TreeFam database of animal gene trees

More...TreeFami		TF333916

Family and domain databases

Conserved Domains Database

More...CDDi		cd13420 TNFRSF25, 1 hit

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR011029 DEATH-like_dom_sf
IPR000488 Death_domain
IPR001368 TNFR/NGFR_Cys_rich_reg
IPR022329 TNFR_25
IPR034050 TNFRSF25_N

Pfam protein domain database

More...Pfami		View protein in Pfam
PF00531 Death, 1 hit
PF00020 TNFR_c6, 1 hit

Protein Motif fingerprint database; a protein domain database

More...PRINTSi		PR01972 TNFACTORR25

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00005 DEATH, 1 hit
SM00208 TNFR, 2 hits

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF47986 SSF47986, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS50017 DEATH_DOMAIN, 1 hit
PS00652 TNFR_NGFR_1, 2 hits
PS50050 TNFR_NGFR_2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (12+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 12 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 12 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q93038-1) [UniParc]FASTAAdd to basket
Also known as: WSL-1, LARD-1A

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MEQRPRGCAA VAAALLLVLL GARAQGGTRS PRCDCAGDFH KKIGLFCCRG 
        60         70         80         90        100
CPAGHYLKAP CTEPCGNSTC LVCPQDTFLA WENHHNSECA RCQACDEQAS 
       110        120        130        140        150
QVALENCSAV ADTRCGCKPG WFVECQVSQC VSSSPFYCQP CLDCGALHRH 
       160        170        180        190        200
TRLLCSRRDT DCGTCLPGFY EHGDGCVSCP TSTLGSCPER CAAVCGWRQM 
       210        220        230        240        250
FWVQVLLAGL VVPLLLGATL TYTYRHCWPH KPLVTADEAG MEALTPPPAT 
       260        270        280        290        300
HLSPLDSAHT LLAPPDSSEK ICTVQLVGNS WTPGYPETQE ALCPQVTWSW 
       310        320        330        340        350
DQLPSRALGP AAAPTLSPES PAGSPAMMLQ PGPQLYDVMD AVPARRWKEF 
       360        370        380        390        400
VRTLGLREAE IEAVEVEIGR FRDQQYEMLK RWRQQQPAGL GAVYAALERM 
       410 
GLDGCVEDLR SRLQRGP
Length:417
Mass (Da):45,385
Last modified:November 1, 1997 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i5226319DFDB46706
GO
Isoform 2 (identifier: Q93038-2) [UniParc]FASTAAdd to basket
Also known as: LARD-1B

The sequence of this isoform differs from the canonical sequence as follows:
     236-236: A → AA

Show »
Length:418
Mass (Da):45,456
Checksum:i54B48F8B35C620E2
GO
Isoform 3 (identifier: Q93038-3) [UniParc]FASTAAdd to basket
Also known as: WSL-S1, LARD-3

The sequence of this isoform differs from the canonical sequence as follows:
     182-218: STLGSCPERCAAVCGWRQMFWVQVLLAGLVVPLLLGA → VLGPGAPGWPCGPPPAWGHPDLHIPPLLASQAPGYCR
     219-417: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Show »
Length:218
Mass (Da):23,198
Checksum:i9B416919AFA442F6
GO
Isoform 4 (identifier: Q93038-4) [UniParc]FASTAAdd to basket
Also known as: WSL-S2, LARD-2

The sequence of this isoform differs from the canonical sequence as follows:
     200-253: MFWVQVLLAG...LTPPPATHLS → SRWCAGNARG...LWSPSCLGPP
     254-417: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Show »
Length:253
Mass (Da):27,004
Checksum:i50A06775B68FC3D7
GO
Isoform 5 (identifier: Q93038-5) [UniParc]FASTAAdd to basket
Also known as: LARD-4, LARD-11

The sequence of this isoform differs from the canonical sequence as follows:
     182-417: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Show »
Length:181
Mass (Da):19,432
Checksum:i59AAFEDBBB46E369
GO
Isoform 6 (identifier: Q93038-6) [UniParc]FASTAAdd to basket
Also known as: LARD-5

The sequence of this isoform differs from the canonical sequence as follows:
     54-98: Missing.
     182-417: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Show »
Length:136
Mass (Da):14,439
Checksum:i6846913006EEE40A
GO
Isoform 7 (identifier: Q93038-7) [UniParc]FASTAAdd to basket
Also known as: LARD-6

The sequence of this isoform differs from the canonical sequence as follows:
     54-98: Missing.
     156-171: SRRDTDCGTCLPGFYE → HPSVTLGQRPHPSSTS
     172-417: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Show »
Length:126
Mass (Da):13,349
Checksum:iEBAC98D7FB3EDB68
GO
Isoform 8 (identifier: Q93038-8) [UniParc]FASTAAdd to basket
Also known as: LARD-7

The sequence of this isoform differs from the canonical sequence as follows:
     54-236: Missing.

Show »
Length:234
Mass (Da):25,373
Checksum:iD082A4552EDF7531
GO
Isoform 9 (identifier: Q93038-9) [UniParc]FASTAAdd to basket
Also known as: LARD-8

The sequence of this isoform differs from the canonical sequence as follows:
     54-98: Missing.

Show »
Length:372
Mass (Da):40,391
Checksum:iD4F87353AB7F40F6
GO
Isoform 10 (identifier: Q93038-10) [UniParc]FASTAAdd to basket
Also known as: LARD-9

The sequence of this isoform differs from the canonical sequence as follows:
     200-237: MFWVQVLLAGLVVPLLLGATLTYTYRHCWPHKPLVTAD → N

Show »
Length:380
Mass (Da):41,193
Checksum:iED19B586ADD947B7
GO
Isoform 11 (identifier: Q93038-11) [UniParc]FASTAAdd to basket
Also known as: Beta

The sequence of this isoform differs from the canonical sequence as follows:
     182-200: STLGSCPERCAAVCGWRQM → PPPSLAGAPWGAVQSAVPLSVAGGRVGV

Show »
Length:426
Mass (Da):45,928
Checksum:i292A9B2899F3AE1F
GO
Isoform 12 (identifier: Q93038-12) [UniParc]FASTAAdd to basket
Also known as: Beta soluble

The sequence of this isoform differs from the canonical sequence as follows:
     182-277: STLGSCPERC...SEKICTVQLV → PPPSLAGAPW...LASQAPGYCR
     278-417: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Show »
Length:277
Mass (Da):29,111
Checksum:i3D19F3E847BFC093
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A3B3ISD9A0A3B3ISD9_HUMAN
Tumor necrosis factor receptor supe...
TNFRSF25
373Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0C4DGF3A0A0C4DGF3_HUMAN
Tumor necrosis factor receptor supe...
TNFRSF25
253Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
K7EJY9K7EJY9_HUMAN
Tumor necrosis factor receptor supe...
TNFRSF25
45Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti4 – 6RPR → AAA in AAC51192 (PubMed:9052839).Curated3
Sequence conflicti4 – 6RPR → AAA in AAC51193 (PubMed:9052839).Curated3
Sequence conflicti60P → H in AAB41435 (Ref. 13) Curated1
Sequence conflicti167P → L (PubMed:9052839).Curated1
Sequence conflicti167P → L (Ref. 13) Curated1
Sequence conflicti312A → R (PubMed:8934525).Curated1
Sequence conflicti312A → R (PubMed:9446802).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_01882623R → Q1 PublicationCorresponds to variant dbSNP:rs35771371Ensembl.1
Natural variantiVAR_018827159D → G2 PublicationsCorresponds to variant dbSNP:rs11800462Ensembl.1
Natural variantiVAR_018828254P → R1 PublicationCorresponds to variant dbSNP:rs34529016Ensembl.1
Natural variantiVAR_011814370R → L. Corresponds to variant dbSNP:rs1064590Ensembl.1
Natural variantiVAR_011815381R → H. Corresponds to variant dbSNP:rs1059333Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_00649254 – 236Missing in isoform 8. 1 PublicationAdd BLAST183
Alternative sequenceiVSP_00649154 – 98Missing in isoform 6, isoform 7 and isoform 9. 1 PublicationAdd BLAST45
Alternative sequenceiVSP_006493156 – 171SRRDT…PGFYE → HPSVTLGQRPHPSSTS in isoform 7. 1 PublicationAdd BLAST16
Alternative sequenceiVSP_006494172 – 417Missing in isoform 7. 1 PublicationAdd BLAST246
Alternative sequenceiVSP_006495182 – 417Missing in isoform 5 and isoform 6. 1 PublicationAdd BLAST236
Alternative sequenceiVSP_006499182 – 277STLGS…TVQLV → PPPSLAGAPWGAVQSAVPLS VAGGRVGGVLGMRVGELGWT EGRRVRRGATTQHPPAAFSV LGPGAPGWPCGPPPAWGHPD LHIPPLLASQAPGYCR in isoform 12. 1 PublicationAdd BLAST96
Alternative sequenceiVSP_006497182 – 218STLGS…LLLGA → VLGPGAPGWPCGPPPAWGHP DLHIPPLLASQAPGYCR in isoform 3. 2 PublicationsAdd BLAST37
Alternative sequenceiVSP_006496182 – 200STLGS…GWRQM → PPPSLAGAPWGAVQSAVPLS VAGGRVGV in isoform 11. 1 PublicationAdd BLAST19
Alternative sequenceiVSP_006501200 – 253MFWVQ…ATHLS → SRWCAGNARGRTGMDRGEAG EEGGNHPTPTSCFQCSGSRC SWLALWSPSCLGPP in isoform 4. 2 PublicationsAdd BLAST54
Alternative sequenceiVSP_006503200 – 237MFWVQ…LVTAD → N in isoform 10. 2 PublicationsAdd BLAST38
Alternative sequenceiVSP_006498219 – 417Missing in isoform 3. 2 PublicationsAdd BLAST199
Alternative sequenceiVSP_006504236A → AA in isoform 2. 1 Publication1
Alternative sequenceiVSP_006502254 – 417Missing in isoform 4. 2 PublicationsAdd BLAST164
Alternative sequenceiVSP_006500278 – 417Missing in isoform 12. 1 PublicationAdd BLAST140

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
Y09392 mRNA Translation: CAA70561.1
Y09392 mRNA Translation: CAA70559.1
Y09392 mRNA Translation: CAA70560.1
U72763 mRNA Translation: AAC50819.1
U83599 Genomic DNA Translation: AAB41434.1
U83600 Genomic DNA Translation: AAB41435.1
U78029 mRNA Translation: AAB40918.1
U74611 mRNA Translation: AAB39714.1
U94501 mRNA Translation: AAC51306.1
U94504 mRNA Translation: AAC51309.1
U94502 mRNA Translation: AAC51307.1
U94503 mRNA Translation: AAC51308.1
U94505 mRNA Translation: AAC51310.1
U94506 mRNA Translation: AAC51311.1
U94507 mRNA Translation: AAC51312.1
U94508 mRNA Translation: AAC51313.1
U94509 mRNA Translation: AAC51314.1
U94510 mRNA Translation: AAC51315.1
U94512 mRNA Translation: AAC51316.1
U83598 mRNA Translation: AAB41433.1
AF026070 mRNA Translation: AAC39556.1
AF026071 mRNA Translation: AAB82288.1
AB051850 Genomic DNA Translation: BAB40662.1
AB051851 Genomic DNA Translation: BAB40663.1
AY358309 mRNA Translation: AAQ88676.1
AY254324 Genomic DNA Translation: AAO63495.1
U75380 mRNA Translation: AAC51192.1
AL158217 Genomic DNA No translation available.
BC117189 mRNA Translation: AAI17190.1
BC143886 mRNA Translation: AAI43887.1
U75381 mRNA Translation: AAC51193.1
U83597 mRNA Translation: AAB41432.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS71.1 [Q93038-1]
CCDS72.1 [Q93038-11]
CCDS73.1 [Q93038-10]
CCDS74.1 [Q93038-9]
CCDS75.1 [Q93038-8]

NCBI Reference Sequences

More...RefSeqi		NP_001034753.1, NM_001039664.1 [Q93038-5]
NP_003781.1, NM_003790.2 [Q93038-1]
NP_683866.1, NM_148965.1 [Q93038-11]
NP_683867.1, NM_148966.1 [Q93038-10]
NP_683868.1, NM_148967.1 [Q93038-9]
NP_683871.1, NM_148970.1 [Q93038-8]

UniGene gene-oriented nucleotide sequence clusters

More...UniGenei		Hs.462529

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000348333; ENSP00000314451; ENSG00000215788 [Q93038-9]
ENST00000351748; ENSP00000326762; ENSG00000215788 [Q93038-8]
ENST00000351959; ENSP00000337713; ENSG00000215788 [Q93038-10]
ENST00000356876; ENSP00000349341; ENSG00000215788 [Q93038-1]
ENST00000377782; ENSP00000367013; ENSG00000215788 [Q93038-11]
ENST00000414040; ENSP00000404274; ENSG00000215788 [Q93038-3]
ENST00000485036; ENSP00000431554; ENSG00000215788 [Q93038-12]
ENST00000502588; ENSP00000423121; ENSG00000215788 [Q93038-6]
ENST00000502730; ENSP00000421976; ENSG00000215788 [Q93038-7]
ENST00000510563; ENSP00000424071; ENSG00000215788 [Q93038-5]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		8718

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:8718

UCSC genome browser

More...UCSCi		uc001ana.4 human [Q93038-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross_references_section">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

NIEHS-SNPs

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
Y09392 mRNA Translation: CAA70561.1
Y09392 mRNA Translation: CAA70559.1
Y09392 mRNA Translation: CAA70560.1
U72763 mRNA Translation: AAC50819.1
U83599 Genomic DNA Translation: AAB41434.1
U83600 Genomic DNA Translation: AAB41435.1
U78029 mRNA Translation: AAB40918.1
U74611 mRNA Translation: AAB39714.1
U94501 mRNA Translation: AAC51306.1
U94504 mRNA Translation: AAC51309.1
U94502 mRNA Translation: AAC51307.1
U94503 mRNA Translation: AAC51308.1
U94505 mRNA Translation: AAC51310.1
U94506 mRNA Translation: AAC51311.1
U94507 mRNA Translation: AAC51312.1
U94508 mRNA Translation: AAC51313.1
U94509 mRNA Translation: AAC51314.1
U94510 mRNA Translation: AAC51315.1
U94512 mRNA Translation: AAC51316.1
U83598 mRNA Translation: AAB41433.1
AF026070 mRNA Translation: AAC39556.1
AF026071 mRNA Translation: AAB82288.1
AB051850 Genomic DNA Translation: BAB40662.1
AB051851 Genomic DNA Translation: BAB40663.1
AY358309 mRNA Translation: AAQ88676.1
AY254324 Genomic DNA Translation: AAO63495.1
U75380 mRNA Translation: AAC51192.1
AL158217 Genomic DNA No translation available.
BC117189 mRNA Translation: AAI17190.1
BC143886 mRNA Translation: AAI43887.1
U75381 mRNA Translation: AAC51193.1
U83597 mRNA Translation: AAB41432.1
CCDSiCCDS71.1 [Q93038-1]
CCDS72.1 [Q93038-11]
CCDS73.1 [Q93038-10]
CCDS74.1 [Q93038-9]
CCDS75.1 [Q93038-8]
RefSeqiNP_001034753.1, NM_001039664.1 [Q93038-5]
NP_003781.1, NM_003790.2 [Q93038-1]
NP_683866.1, NM_148965.1 [Q93038-11]
NP_683867.1, NM_148966.1 [Q93038-10]
NP_683868.1, NM_148967.1 [Q93038-9]
NP_683871.1, NM_148970.1 [Q93038-8]
UniGeneiHs.462529

3D structure databases

ProteinModelPortaliQ93038
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi114258, 11 interactors
DIPiDIP-59563N
IntActiQ93038, 1 interactor

PTM databases

iPTMnetiQ93038

Polymorphism and mutation databases

BioMutaiTNFRSF25
DMDMi2501233

Proteomic databases

jPOSTiQ93038
PeptideAtlasiQ93038
PRIDEiQ93038
ProteomicsDBi75674
75675 [Q93038-10]
75676 [Q93038-11]
75677 [Q93038-12]
75678 [Q93038-2]
75679 [Q93038-3]
75680 [Q93038-4]
75681 [Q93038-5]
75682 [Q93038-6]
75683 [Q93038-7]
75684 [Q93038-8]
75685 [Q93038-9]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000348333; ENSP00000314451; ENSG00000215788 [Q93038-9]
ENST00000351748; ENSP00000326762; ENSG00000215788 [Q93038-8]
ENST00000351959; ENSP00000337713; ENSG00000215788 [Q93038-10]
ENST00000356876; ENSP00000349341; ENSG00000215788 [Q93038-1]
ENST00000377782; ENSP00000367013; ENSG00000215788 [Q93038-11]
ENST00000414040; ENSP00000404274; ENSG00000215788 [Q93038-3]
ENST00000485036; ENSP00000431554; ENSG00000215788 [Q93038-12]
ENST00000502588; ENSP00000423121; ENSG00000215788 [Q93038-6]
ENST00000502730; ENSP00000421976; ENSG00000215788 [Q93038-7]
ENST00000510563; ENSP00000424071; ENSG00000215788 [Q93038-5]
GeneIDi8718
KEGGihsa:8718
UCSCiuc001ana.4 human [Q93038-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		8718
DisGeNETi8718
EuPathDBiHostDB:ENSG00000215788.9

GeneCards: human genes, protein and diseases

More...GeneCardsi		TNFRSF25
HGNCiHGNC:11910 TNFRSF25
HPAiHPA069834
MIMi603366 gene
neXtProtiNX_Q93038
OpenTargetsiENSG00000215788
PharmGKBiPA36603

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

GeneTreeiENSGT00940000161888
HOVERGENiHBG058493
InParanoidiQ93038
KOiK05160
OMAiRALHRHT
OrthoDBi726174at2759
PhylomeDBiQ93038
TreeFamiTF333916

Enzyme and pathway databases

ReactomeiR-HSA-5669034 TNFs bind their physiological receptors
SIGNORiQ93038

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		TNFRSF25 human

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		TNFRSF25

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		8718

Protein Ontology

More...PROi		PR:Q93038

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000215788 Expressed in 180 organ(s), highest expression level in right hemisphere of cerebellum
ExpressionAtlasiQ93038 baseline and differential
GenevisibleiQ93038 HS

Family and domain databases

CDDicd13420 TNFRSF25, 1 hit
InterProiView protein in InterPro
IPR011029 DEATH-like_dom_sf
IPR000488 Death_domain
IPR001368 TNFR/NGFR_Cys_rich_reg
IPR022329 TNFR_25
IPR034050 TNFRSF25_N
PfamiView protein in Pfam
PF00531 Death, 1 hit
PF00020 TNFR_c6, 1 hit
PRINTSiPR01972 TNFACTORR25
SMARTiView protein in SMART
SM00005 DEATH, 1 hit
SM00208 TNFR, 2 hits
SUPFAMiSSF47986 SSF47986, 1 hit
PROSITEiView protein in PROSITE
PS50017 DEATH_DOMAIN, 1 hit
PS00652 TNFR_NGFR_1, 2 hits
PS50050 TNFR_NGFR_2, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiTNR25_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q93038
Secondary accession number(s): B1ALX2
, B1ALX3, B7ZLL7, O00275, O00276, O00277, O00278, O00279, O00280, O14865, O14866, P78507, P78515, Q17RU4, Q92983, Q93036, Q93037, Q99722, Q99830, Q99831, Q9BY86, Q9UME0, Q9UME1, Q9UME5
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: November 1, 1997
Last modified: January 16, 2019
This is version 180 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again