Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Ubiquitin recognition factor in ER-associated degradation protein 1

Gene

UFD1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Essential component of the ubiquitin-dependent proteolytic pathway which degrades ubiquitin fusion proteins. The ternary complex containing UFD1, VCP and NPLOC4 binds ubiquitinated proteins and is necessary for the export of misfolded proteins from the ER to the cytoplasm, where they are degraded by the proteasome. The NPLOC4-UFD1-VCP complex regulates spindle disassembly at the end of mitosis and is necessary for the formation of a closed nuclear envelope. It may be involved in the development of some ectoderm-derived structures (By similarity). Acts as a negative regulator of type I interferon production via the complex formed with VCP and NPLOC4, which binds to DDX58/RIG-I and recruits RNF125 to promote ubiquitination and degradation of DDX58/RIG-I (PubMed:26471729).By similarity1 Publication

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section describes the metabolic pathway(s) associated with a protein.<p><a href='/help/pathway' target='_top'>More...</a></p>Pathwayi: proteasomal ubiquitin-dependent pathway

This protein is involved in the pathway proteasomal ubiquitin-dependent pathway, which is part of Protein degradation.By similarity
View all proteins of this organism that are known to be involved in the pathway proteasomal ubiquitin-dependent pathway and in Protein degradation.

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processUbl conjugation pathway

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-110320 Translesion Synthesis by POLH
R-HSA-5689880 Ub-specific processing proteases

SIGNOR Signaling Network Open Resource

More...
SIGNORi
Q92890

UniPathway: a resource for the exploration and annotation of metabolic pathways

More...
UniPathwayi
UPA00144

Protein family/group databases

MoonDB Database of extreme multifunctional and moonlighting proteins

More...
MoonDBi
Q92890 Predicted

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Ubiquitin recognition factor in ER-associated degradation protein 1Imported
Alternative name(s):
Ubiquitin fusion degradation protein 1
Short name:
UB fusion protein 1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:UFD1Imported
Synonyms:UFD1L
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 22

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000070010.18

Human Gene Nomenclature Database

More...
HGNCi
HGNC:12520 UFD1

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
601754 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q92890

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
7353

MalaCards human disease database

More...
MalaCardsi
UFD1

Open Targets

More...
OpenTargetsi
ENSG00000070010

Orphanet; a database dedicated to information on rare diseases and orphan drugs

More...
Orphaneti
567 22q11.2 deletion syndrome

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA37167

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
UFD1

Domain mapping of disease mutations (DMDM)

More...
DMDMi
160332310

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001949841 – 307Ubiquitin recognition factor in ER-associated degradation protein 1Add BLAST307

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei1N-acetylmethionineCombined sources1
Modified residuei129PhosphoserineCombined sources1
Modified residuei231PhosphoserineCombined sources1
Modified residuei245PhosphoserineCombined sources1
Modified residuei247PhosphoserineCombined sources1
Modified residuei299PhosphoserineCombined sources1

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q92890

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q92890

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q92890

PeptideAtlas

More...
PeptideAtlasi
Q92890

PRoteomics IDEntifications database

More...
PRIDEi
Q92890

ProteomicsDB human proteome resource

More...
ProteomicsDBi
75576
75577 [Q92890-1]

2D gel databases

USC-OGP 2-DE database

More...
OGPi
Q92890

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q92890

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q92890

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Found in adult heart, skeletal muscle and pancreas, and in fetal liver and kidney.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000070010 Expressed in 229 organ(s), highest expression level in chorionic villus

CleanEx database of gene expression profiles

More...
CleanExi
HS_UFD1L

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q92890 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q92890 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA030287
HPA030288
HPA073425

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Heterodimer with NPLOC4, this heterodimer binds VCP and inhibits Golgi membrane fusion (PubMed:11574150, PubMed:26471729). Interacts with USP13 (PubMed:21571647). Interacts with ZFAND2B; probably through VCP (PubMed:24160817).4 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
113200, 105 interactors

ComplexPortal: manually curated resource of macromolecular complexes

More...
ComplexPortali
CPX-137 VCP-NPL4-UFD1 AAA ATPase complex

CORUM comprehensive resource of mammalian protein complexes

More...
CORUMi
Q92890

Database of interacting proteins

More...
DIPi
DIP-45954N

Protein interaction database and analysis system

More...
IntActi
Q92890, 32 interactors

Molecular INTeraction database

More...
MINTi
Q92890

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000263202

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1307
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2YUJNMR-A11-193[»]
5B6CX-ray1.55B225-235[»]
5C1BX-ray3.08U/V221-241[»]

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q92890

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q92890

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
Q92890

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the UFD1 family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1816 Eukaryota
COG5140 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000002408

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000212737

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG001266

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q92890

KEGG Orthology (KO)

More...
KOi
K14016

Identification of Orthologs from Complete Genome Data

More...
OMAi
PNYDFKI

Database of Orthologous Groups

More...
OrthoDBi
1556447at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q92890

TreeFam database of animal gene trees

More...
TreeFami
TF314581

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR004854 Ufd1-like

The PANTHER Classification System

More...
PANTHERi
PTHR12555 PTHR12555, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF03152 UFD1, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

Isoform Short (identifier: Q92890-2) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MFSFNMFDHP IPRVFQNRFS TQYRCFSVSM LAGPNDRSDV EKGGKIIMPP
60 70 80 90 100
SALDQLSRLN ITYPMLFKLT NKNSDRMTHC GVLEFVADEG ICYLPHWMMQ
110 120 130 140 150
NLLLEEGGLV QVESVNLQVA TYSKFQPQSP DFLDITNPKA VLENALRNFA
160 170 180 190 200
CLTTGDVIAI NYNEKIYELR VMETKPDKAV SIIECDMNVD FDAPLGYKEP
210 220 230 240 250
ERQVQHEEST EGEADHSGYA GELGFRAFSG SGNRLDGKKK GVEPSPSPIK
260 270 280 290 300
PGDIKRGIPN YEFKLGKITF IRNSRPLVKK VEEDEAGGRF VAFSGEGQSL

RKKGRKP
Note: Major isoform.
Length:307
Mass (Da):34,500
Last modified:November 13, 2007 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iFC69860002C042C6
GO
Isoform Long (identifier: Q92890-1) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     106-106: E → EDGLVQLETVNLQVATYSKSKFCYLPHWMMQNLLLEE

Show »
Length:343
Mass (Da):38,725
Checksum:i94D55B70E7F5A27F
GO
Isoform 3 (identifier: Q92890-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     267-307: Missing.

Note: No experimental confirmation available.
Show »
Length:266
Mass (Da):29,901
Checksum:i8CE8E9AE3BF71ED6
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
C9IZG3C9IZG3_HUMAN
Ubiquitin recognition factor in ER-...
UFD1
190Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9J6N9C9J6N9_HUMAN
Ubiquitin recognition factor in ER-...
UFD1
135Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9J7C8C9J7C8_HUMAN
Ubiquitin recognition factor in ER-...
UFD1
69Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9JNP9C9JNP9_HUMAN
Ubiquitin recognition factor in ER-...
UFD1
159Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti25C → R in AK225877 (Ref. 4) Curated1
Sequence conflicti33G → W in AAD08720 (PubMed:9063746).Curated1
Sequence conflicti183I → H in AAD08720 (PubMed:9063746).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_052436130P → A1 PublicationCorresponds to variant dbSNP:rs17744624Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_006707106E → EDGLVQLETVNLQVATYSKS KFCYLPHWMMQNLLLEE in isoform Long. 1 Publication1
Alternative sequenceiVSP_045044267 – 307Missing in isoform 3. 1 PublicationAdd BLAST41

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
U64444 mRNA Translation: AAD08720.1
AF141201 mRNA Translation: AAD28788.1
CR456607 mRNA Translation: CAG30493.1
AK225877 mRNA No translation available.
AC000068 Genomic DNA No translation available.
AC000087 Genomic DNA No translation available.
BC001049 mRNA Translation: AAH01049.1
BC005087 mRNA Translation: AAH05087.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS13761.1 [Q92890-2]
CCDS33600.2 [Q92890-3]

NCBI Reference Sequences

More...
RefSeqi
NP_001030324.2, NM_001035247.2 [Q92890-3]
NP_005650.2, NM_005659.6 [Q92890-2]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.474213

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000263202; ENSP00000263202; ENSG00000070010 [Q92890-2]
ENST00000399523; ENSP00000382439; ENSG00000070010 [Q92890-3]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
7353

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:7353

UCSC genome browser

More...
UCSCi
uc002zpm.3 human [Q92890-2]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U64444 mRNA Translation: AAD08720.1
AF141201 mRNA Translation: AAD28788.1
CR456607 mRNA Translation: CAG30493.1
AK225877 mRNA No translation available.
AC000068 Genomic DNA No translation available.
AC000087 Genomic DNA No translation available.
BC001049 mRNA Translation: AAH01049.1
BC005087 mRNA Translation: AAH05087.1
CCDSiCCDS13761.1 [Q92890-2]
CCDS33600.2 [Q92890-3]
RefSeqiNP_001030324.2, NM_001035247.2 [Q92890-3]
NP_005650.2, NM_005659.6 [Q92890-2]
UniGeneiHs.474213

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2YUJNMR-A11-193[»]
5B6CX-ray1.55B225-235[»]
5C1BX-ray3.08U/V221-241[»]
ProteinModelPortaliQ92890
SMRiQ92890
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi113200, 105 interactors
ComplexPortaliCPX-137 VCP-NPL4-UFD1 AAA ATPase complex
CORUMiQ92890
DIPiDIP-45954N
IntActiQ92890, 32 interactors
MINTiQ92890
STRINGi9606.ENSP00000263202

Protein family/group databases

MoonDBiQ92890 Predicted

PTM databases

iPTMnetiQ92890
PhosphoSitePlusiQ92890

Polymorphism and mutation databases

BioMutaiUFD1
DMDMi160332310

2D gel databases

OGPiQ92890

Proteomic databases

EPDiQ92890
jPOSTiQ92890
PaxDbiQ92890
PeptideAtlasiQ92890
PRIDEiQ92890
ProteomicsDBi75576
75577 [Q92890-1]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
7353
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000263202; ENSP00000263202; ENSG00000070010 [Q92890-2]
ENST00000399523; ENSP00000382439; ENSG00000070010 [Q92890-3]
GeneIDi7353
KEGGihsa:7353
UCSCiuc002zpm.3 human [Q92890-2]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
7353
DisGeNETi7353
EuPathDBiHostDB:ENSG00000070010.18

GeneCards: human genes, protein and diseases

More...
GeneCardsi
UFD1
HGNCiHGNC:12520 UFD1
HPAiHPA030287
HPA030288
HPA073425
MalaCardsiUFD1
MIMi601754 gene
neXtProtiNX_Q92890
OpenTargetsiENSG00000070010
Orphaneti567 22q11.2 deletion syndrome
PharmGKBiPA37167

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG1816 Eukaryota
COG5140 LUCA
GeneTreeiENSGT00390000002408
HOGENOMiHOG000212737
HOVERGENiHBG001266
InParanoidiQ92890
KOiK14016
OMAiPNYDFKI
OrthoDBi1556447at2759
PhylomeDBiQ92890
TreeFamiTF314581

Enzyme and pathway databases

UniPathwayi
UPA00144

ReactomeiR-HSA-110320 Translesion Synthesis by POLH
R-HSA-5689880 Ub-specific processing proteases
SIGNORiQ92890

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
UFD1L human
EvolutionaryTraceiQ92890

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
UFD1L

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
7353

Protein Ontology

More...
PROi
PR:Q92890

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000070010 Expressed in 229 organ(s), highest expression level in chorionic villus
CleanExiHS_UFD1L
ExpressionAtlasiQ92890 baseline and differential
GenevisibleiQ92890 HS

Family and domain databases

InterProiView protein in InterPro
IPR004854 Ufd1-like
PANTHERiPTHR12555 PTHR12555, 1 hit
PfamiView protein in Pfam
PF03152 UFD1, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiUFD1_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q92890
Secondary accession number(s): A8MW31, Q9Y5N0
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: November 13, 2007
Last modified: January 16, 2019
This is version 159 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 22
    Human chromosome 22: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  6. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  7. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again