Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 199 (22 Apr 2020)
Sequence version 2 (17 Oct 2006)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Neogenin

Gene

NEO1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Multi-functional cell surface receptor regulating cell adhesion in many diverse developmental processes, including neural tube and mammary gland formation, myogenesis and angiogenesis. Receptor for members of the BMP, netrin, and repulsive guidance molecule (RGM) families. Netrin-Neogenin interactions result in a chemoattractive axon guidance response and cell-cell adhesion, the interaction between NEO1/Neogenin and RGMa and RGMb induces a chemorepulsive response.1 Publication

Miscellaneous

Knockdown of NEO1 in C2C12 cells results in the enhancement of the BMP-2-induced processes of osteoblastic differentiation and phosphorylation of Smad1, Smad5, and Smad8. Conversely, overexpression suppresses these processes.

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processCell adhesion

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-373752 Netrin-1 signaling
R-HSA-525793 Myogenesis

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Neogenin
Alternative name(s):
Immunoglobulin superfamily DCC subclass member 2
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:NEO1
Synonyms:IGDCC2, NGN
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 15

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:7754 NEO1

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
601907 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q92859

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini34 – 1105ExtracellularSequence analysisAdd BLAST1072
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei1106 – 1126HelicalSequence analysisAdd BLAST21
Topological domaini1127 – 1461CytoplasmicSequence analysisAdd BLAST335

Keywords - Cellular componenti

Cell membrane, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
4756

Open Targets

More...
OpenTargetsi
ENSG00000067141

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA31555

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q92859 Tbio

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
NEO1

Domain mapping of disease mutations (DMDM)

More...
DMDMi
116242676

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 33Sequence analysisAdd BLAST33
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000001504334 – 1461NeogeninAdd BLAST1428

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi73N-linked (GlcNAc...) asparagineSequence analysis1
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi74 ↔ 129PROSITE-ProRule annotation
Disulfide bondi173 ↔ 221PROSITE-ProRule annotation
Glycosylationi210N-linked (GlcNAc...) asparagine2 Publications1
Disulfide bondi270 ↔ 320PROSITE-ProRule annotation
Glycosylationi326N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi362 ↔ 410PROSITE-ProRule annotation
Glycosylationi470N-linked (GlcNAc...) asparagine1 Publication1
Glycosylationi489N-linked (GlcNAc...) asparagine1 Publication1
Glycosylationi639N-linked (GlcNAc...) asparagine1 Publication1
Glycosylationi715N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi909N-linked (GlcNAc...) asparagineSequence analysis1
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei1178PhosphoserineBy similarity1
Modified residuei1194PhosphoserineCombined sources1
Modified residuei1198PhosphothreonineCombined sources1
Modified residuei1401PhosphoserineCombined sources1
Modified residuei1404PhosphothreonineCombined sources1
Modified residuei1432PhosphoserineBy similarity1
Modified residuei1434PhosphoserineCombined sources1
Modified residuei1435PhosphoserineBy similarity1

Keywords - PTMi

Disulfide bond, Glycoprotein, Phosphoprotein

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q92859

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q92859

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q92859

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q92859

PeptideAtlas

More...
PeptideAtlasi
Q92859

PRoteomics IDEntifications database

More...
PRIDEi
Q92859

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
7185
75552 [Q92859-1]
75553 [Q92859-2]
75554 [Q92859-3]

PTM databases

GlyConnect protein glycosylation platform

More...
GlyConnecti
1539

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q92859

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q92859

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Widely expressed and also in cancer cell lines.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000067141 Expressed in globus pallidus and 223 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q92859 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q92859 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000067141 Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with MYO10 (By similarity).

Interacts with RGMA and RGMB.

Interacts with BMP2, BMP4, BMP6, and BMP7.

By similarity2 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
110830, 14 interactors

Database of interacting proteins

More...
DIPi
DIP-46272N

Protein interaction database and analysis system

More...
IntActi
Q92859, 8 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000341198

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q92859 protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

11461
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q92859

Database of comparative protein structure models

More...
ModBasei
Search...

Protein Data Bank in Europe - Knowledge Base

More...
PDBe-KBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
Q92859

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini52 – 141Ig-like C2-type 1Add BLAST90
Domaini152 – 238Ig-like C2-type 2Add BLAST87
Domaini243 – 336Ig-like C2-type 3Add BLAST94
Domaini341 – 426Ig-like C2-type 4Add BLAST86
Domaini441 – 535Fibronectin type-III 1PROSITE-ProRule annotationAdd BLAST95
Domaini541 – 631Fibronectin type-III 2PROSITE-ProRule annotationAdd BLAST91
Domaini636 – 731Fibronectin type-III 3PROSITE-ProRule annotationAdd BLAST96
Domaini741 – 831Fibronectin type-III 4PROSITE-ProRule annotationAdd BLAST91
Domaini856 – 952Fibronectin type-III 5PROSITE-ProRule annotationAdd BLAST97
Domaini957 – 1054Fibronectin type-III 6PROSITE-ProRule annotationAdd BLAST98

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi1118 – 1121Poly-Val4

<p>This subsection of the 'Family and domains' section provides general information on the biological role of a domain. The term 'domain' is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The Fibronectin repeats 5 and 6 mediate interaction with RGM family molecules.By similarity

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the immunoglobulin superfamily. DCC family.Curated

Keywords - Domaini

Immunoglobulin domain, Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG4221 Eukaryota
ENOG410Z913 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000156684

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q92859

KEGG Orthology (KO)

More...
KOi
K06766

Identification of Orthologs from Complete Genome Data

More...
OMAi
PPKHTVG

Database of Orthologous Groups

More...
OrthoDBi
217780at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q92859

TreeFam database of animal gene trees

More...
TreeFami
TF321506

Family and domain databases

Conserved Domains Database

More...
CDDi
cd00063 FN3, 6 hits

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
2.60.40.10, 10 hits

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR003961 FN3_dom
IPR036116 FN3_sf
IPR007110 Ig-like_dom
IPR036179 Ig-like_dom_sf
IPR013783 Ig-like_fold
IPR013098 Ig_I-set
IPR003599 Ig_sub
IPR003598 Ig_sub2
IPR033024 Neogenin
IPR010560 Neogenin_C

The PANTHER Classification System

More...
PANTHERi
PTHR44170:SF14 PTHR44170:SF14, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00041 fn3, 6 hits
PF07679 I-set, 2 hits
PF13895 Ig_2, 1 hit
PF06583 Neogenin_C, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00060 FN3, 6 hits
SM00409 IG, 4 hits
SM00408 IGc2, 4 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF48726 SSF48726, 4 hits
SSF49265 SSF49265, 4 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50853 FN3, 6 hits
PS50835 IG_LIKE, 4 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Note: Additional isoforms seem to exist.

This entry has 4 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q92859-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAAERGARRL LSTPSFWLYC LLLLGRRAPG AAAARSGSAP QSPGASIRTF
60 70 80 90 100
TPFYFLVEPV DTLSVRGSSV ILNCSAYSEP SPKIEWKKDG TFLNLVSDDR
110 120 130 140 150
RQLLPDGSLF ISNVVHSKHN KPDEGYYQCV ATVESLGTII SRTAKLIVAG
160 170 180 190 200
LPRFTSQPEP SSVYAGNNAI LNCEVNADLV PFVRWEQNRQ PLLLDDRVIK
210 220 230 240 250
LPSGMLVISN ATEGDGGLYR CVVESGGPPK YSDEVELKVL PDPEVISDLV
260 270 280 290 300
FLKQPSPLVR VIGQDVVLPC VASGLPTPTI KWMKNEEALD TESSERLVLL
310 320 330 340 350
AGGSLEISDV TEDDAGTYFC IADNGNETIE AQAELTVQAQ PEFLKQPTNI
360 370 380 390 400
YAHESMDIVF ECEVTGKPTP TVKWVKNGDM VIPSDYFKIV KEHNLQVLGL
410 420 430 440 450
VKSDEGFYQC IAENDVGNAQ AGAQLIILEH APATTGPLPS APRDVVASLV
460 470 480 490 500
STRFIKLTWR TPASDPHGDN LTYSVFYTKE GIARERVENT SHPGEMQVTI
510 520 530 540 550
QNLMPATVYI FRVMAQNKHG SGESSAPLRV ETQPEVQLPG PAPNLRAYAA
560 570 580 590 600
SPTSITVTWE TPVSGNGEIQ NYKLYYMEKG TDKEQDVDVS SHSYTINGLK
610 620 630 640 650
KYTEYSFRVV AYNKHGPGVS TPDVAVRTLS DVPSAAPQNL SLEVRNSKSI
660 670 680 690 700
MIHWQPPAPA TQNGQITGYK IRYRKASRKS DVTETLVSGT QLSQLIEGLD
710 720 730 740 750
RGTEYNFRVA ALTINGTGPA TDWLSAETFE SDLDETRVPE VPSSLHVRPL
760 770 780 790 800
VTSIVVSWTP PENQNIVVRG YAIGYGIGSP HAQTIKVDYK QRYYTIENLD
810 820 830 840 850
PSSHYVITLK AFNNVGEGIP LYESAVTRPH TDTSEVDLFV INAPYTPVPD
860 870 880 890 900
PTPMMPPVGV QASILSHDTI RITWADNSLP KHQKITDSRY YTVRWKTNIP
910 920 930 940 950
ANTKYKNANA TTLSYLVTGL KPNTLYEFSV MVTKGRRSST WSMTAHGTTF
960 970 980 990 1000
ELVPTSPPKD VTVVSKEGKP KTIIVNWQPP SEANGKITGY IIYYSTDVNA
1010 1020 1030 1040 1050
EIHDWVIEPV VGNRLTHQIQ ELTLDTPYYF KIQARNSKGM GPMSEAVQFR
1060 1070 1080 1090 1100
TPKADSSDKM PNDQASGSGG KGSRLPDLGS DYKPPMSGSN SPHGSPTSPL
1110 1120 1130 1140 1150
DSNMLLVIIV SVGVITIVVV VIIAVFCTRR TTSHQKKKRA ACKSVNGSHK
1160 1170 1180 1190 1200
YKGNSKDVKP PDLWIHHERL ELKPIDKSPD PNPIMTDTPI PRNSQDITPV
1210 1220 1230 1240 1250
DNSMDSNIHQ RRNSYRGHES EDSMSTLAGR RGMRPKMMMP FDSQPPQPVI
1260 1270 1280 1290 1300
SAHPIHSLDN PHHHFHSSSL ASPARSHLYH PGSPWPIGTS MSLSDRANST
1310 1320 1330 1340 1350
ESVRNTPSTD TMPASSSQTC CTDHQDPEGA TSSSYLASSQ EEDSGQSLPT
1360 1370 1380 1390 1400
AHVRPSHPLK SFAVPAIPPP GPPTYDPALP STPLLSQQAL NHHIHSVKTA
1410 1420 1430 1440 1450
SIGTLGRSRP PMPVVVPSAP EVQETTRMLE DSESSYEPDE LTKEMAHLEG
1460
LMKDLNAITT A
Length:1,461
Mass (Da):160,017
Last modified:October 17, 2006 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i4AADF1EEBCAFD82C
GO
Isoform 2 (identifier: Q92859-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1248-1300: Missing.

Show »
Length:1,408
Mass (Da):154,304
Checksum:iE71D70CACE393061
GO
Isoform 3 (identifier: Q92859-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1248-1301: PVISAHPIHSLDNPHHHFHSSSLASPARSHLYHPGSPWPIGTSMSLSDRANSTE → Q

Show »
Length:1,408
Mass (Da):154,303
Checksum:i5E55E8130FF92C7C
GO
Isoform 4 (identifier: Q92859-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1054-1064: Missing.

Show »
Length:1,450
Mass (Da):158,827
Checksum:iCCD38B29A4B340D8
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
Q59FP8Q59FP8_HUMAN
Neogenin
NEO1
1,130Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti168N → G in AAB17263 (PubMed:9121761).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_027954534P → L. Corresponds to variant dbSNP:rs4467039Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0471341054 – 1064Missing in isoform 4. 1 PublicationAdd BLAST11
Alternative sequenceiVSP_0433301248 – 1301PVISA…ANSTE → Q in isoform 3. 1 PublicationAdd BLAST54
Alternative sequenceiVSP_0025931248 – 1300Missing in isoform 2. 2 PublicationsAdd BLAST53

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
U61262 mRNA Translation: AAB17263.1
U72391 mRNA Translation: AAC51287.1
AC068397 Genomic DNA No translation available.
AC104420 Genomic DNA No translation available.
AC129980 Genomic DNA No translation available.
BC117161 mRNA Translation: AAI17162.1
BC143270 mRNA Translation: AAI43271.1
BC143271 mRNA Translation: AAI43272.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS10247.1 [Q92859-1]
CCDS53957.1 [Q92859-3]
CCDS58378.1 [Q92859-4]

NCBI Reference Sequences

More...
RefSeqi
NP_001166094.1, NM_001172623.1 [Q92859-3]
NP_001166095.1, NM_001172624.1 [Q92859-4]
NP_002490.2, NM_002499.3 [Q92859-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000261908; ENSP00000261908; ENSG00000067141 [Q92859-1]
ENST00000339362; ENSP00000341198; ENSG00000067141 [Q92859-1]
ENST00000558964; ENSP00000453200; ENSG00000067141 [Q92859-4]
ENST00000560262; ENSP00000453317; ENSG00000067141 [Q92859-3]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
4756

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:4756

UCSC genome browser

More...
UCSCi
uc002avm.4 human [Q92859-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U61262 mRNA Translation: AAB17263.1
U72391 mRNA Translation: AAC51287.1
AC068397 Genomic DNA No translation available.
AC104420 Genomic DNA No translation available.
AC129980 Genomic DNA No translation available.
BC117161 mRNA Translation: AAI17162.1
BC143270 mRNA Translation: AAI43271.1
BC143271 mRNA Translation: AAI43272.1
CCDSiCCDS10247.1 [Q92859-1]
CCDS53957.1 [Q92859-3]
CCDS58378.1 [Q92859-4]
RefSeqiNP_001166094.1, NM_001172623.1 [Q92859-3]
NP_001166095.1, NM_001172624.1 [Q92859-4]
NP_002490.2, NM_002499.3 [Q92859-1]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1X5FNMR-A429-535[»]
1X5GNMR-A529-631[»]
1X5HNMR-A623-741[»]
1X5INMR-A719-831[»]
1X5JNMR-A853-952[»]
1X5KNMR-A944-1054[»]
3P4LX-ray1.80A853-1054[»]
SMRiQ92859
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGridi110830, 14 interactors
DIPiDIP-46272N
IntActiQ92859, 8 interactors
STRINGi9606.ENSP00000341198

PTM databases

GlyConnecti1539
iPTMnetiQ92859
PhosphoSitePlusiQ92859

Polymorphism and mutation databases

BioMutaiNEO1
DMDMi116242676

Proteomic databases

jPOSTiQ92859
MassIVEiQ92859
MaxQBiQ92859
PaxDbiQ92859
PeptideAtlasiQ92859
PRIDEiQ92859
ProteomicsDBi7185
75552 [Q92859-1]
75553 [Q92859-2]
75554 [Q92859-3]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
3989 187 antibodies

Genome annotation databases

EnsembliENST00000261908; ENSP00000261908; ENSG00000067141 [Q92859-1]
ENST00000339362; ENSP00000341198; ENSG00000067141 [Q92859-1]
ENST00000558964; ENSP00000453200; ENSG00000067141 [Q92859-4]
ENST00000560262; ENSP00000453317; ENSG00000067141 [Q92859-3]
GeneIDi4756
KEGGihsa:4756
UCSCiuc002avm.4 human [Q92859-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
4756
DisGeNETi4756

GeneCards: human genes, protein and diseases

More...
GeneCardsi
NEO1
HGNCiHGNC:7754 NEO1
HPAiENSG00000067141 Low tissue specificity
MIMi601907 gene
neXtProtiNX_Q92859
OpenTargetsiENSG00000067141
PharmGKBiPA31555

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG4221 Eukaryota
ENOG410Z913 LUCA
GeneTreeiENSGT00940000156684
InParanoidiQ92859
KOiK06766
OMAiPPKHTVG
OrthoDBi217780at2759
PhylomeDBiQ92859
TreeFamiTF321506

Enzyme and pathway databases

ReactomeiR-HSA-373752 Netrin-1 signaling
R-HSA-525793 Myogenesis

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
NEO1 human
EvolutionaryTraceiQ92859

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
NEO1

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
4756
PharosiQ92859 Tbio

Protein Ontology

More...
PROi
PR:Q92859
RNActiQ92859 protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000067141 Expressed in globus pallidus and 223 other tissues
ExpressionAtlasiQ92859 baseline and differential
GenevisibleiQ92859 HS

Family and domain databases

CDDicd00063 FN3, 6 hits
Gene3Di2.60.40.10, 10 hits
InterProiView protein in InterPro
IPR003961 FN3_dom
IPR036116 FN3_sf
IPR007110 Ig-like_dom
IPR036179 Ig-like_dom_sf
IPR013783 Ig-like_fold
IPR013098 Ig_I-set
IPR003599 Ig_sub
IPR003598 Ig_sub2
IPR033024 Neogenin
IPR010560 Neogenin_C
PANTHERiPTHR44170:SF14 PTHR44170:SF14, 1 hit
PfamiView protein in Pfam
PF00041 fn3, 6 hits
PF07679 I-set, 2 hits
PF13895 Ig_2, 1 hit
PF06583 Neogenin_C, 1 hit
SMARTiView protein in SMART
SM00060 FN3, 6 hits
SM00409 IG, 4 hits
SM00408 IGc2, 4 hits
SUPFAMiSSF48726 SSF48726, 4 hits
SSF49265 SSF49265, 4 hits
PROSITEiView protein in PROSITE
PS50853 FN3, 6 hits
PS50835 IG_LIKE, 4 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiNEO1_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q92859
Secondary accession number(s): B7ZKM9
, B7ZKN0, O00340, Q17RX1
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: December 1, 2000
Last sequence update: October 17, 2006
Last modified: April 22, 2020
This is version 199 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. Human chromosome 15
    Human chromosome 15: entries, gene names and cross-references to MIM
  6. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again