Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 205 (08 May 2019)
Sequence version 3 (11 Jan 2001)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Caspase-10

Gene

CASP10

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Involved in the activation cascade of caspases responsible for apoptosis execution. Recruited to both Fas- and TNFR-1 receptors in a FADD dependent manner. May participate in the granzyme B apoptotic pathways. Cleaves and activates caspase-3, -4, -6, -7, -8, and -9. Hydrolyzes the small- molecule substrates, Tyr-Val-Ala-Asp-|-AMC and Asp-Glu-Val-Asp-|-AMC.1 Publication
Isoform 7 can enhance NF-kappaB activity but promotes only slight apoptosis.1 Publication
Isoform C is proteolytically inactive.1 Publication

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

  • Strict requirement for Asp at position P1 and has a preferred cleavage sequence of Leu-Gln-Thr-Asp-|-Gly. EC:3.4.22.63

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Function’ section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei358By similarity1
Active sitei401By similarity1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionHydrolase, Protease, Thiol protease
Biological processApoptosis

Enzyme and pathway databases

BRENDA Comprehensive Enzyme Information System

More...
BRENDAi
3.4.22.63 2681

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-6803207 TP53 Regulates Transcription of Caspase Activators and Caspases
R-HSA-75157 FasL/ CD95L signaling
R-HSA-75158 TRAIL signaling
R-HSA-933543 NF-kB activation through FADD/RIP-1 pathway mediated by caspase-8 and -10

SIGNOR Signaling Network Open Resource

More...
SIGNORi
Q92851

Protein family/group databases

MEROPS protease database

More...
MEROPSi
C14.011

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Caspase-10 (EC:3.4.22.63)
Short name:
CASP-10
Alternative name(s):
Apoptotic protease Mch-4
FAS-associated death domain protein interleukin-1B-converting enzyme 2
Short name:
FLICE2
ICE-like apoptotic protease 4
Cleaved into the following 2 chains:
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:CASP10
Synonyms:MCH4
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 2

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:1500 CASP10

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
601762 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q92851

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the ‘Pathology and Biotech’ section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

Autoimmune lymphoproliferative syndrome 2A (ALPS2A)1 Publication
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionA disorder of apoptosis that manifests in early childhood and results in the accumulation of autoreactive lymphocytes. It is characterized by non-malignant lymphadenopathy with hepatosplenomegaly, and autoimmune hemolytic anemia, thrombocytopenia and neutropenia.
See also OMIM:603909
Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_014071285L → F in ALPS2A. 1 PublicationCorresponds to variant dbSNP:rs17860403EnsemblClinVar.1
Familial non-Hodgkin lymphoma (NHL)1 Publication
The gene represented in this entry is involved in disease pathogenesis.
Disease descriptionCancer that starts in cells of the lymph system, which is part of the body's immune system. NHLs can occur at any age and are often marked by enlarged lymph nodes, fever and weight loss.
See also OMIM:605027
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_037430414A → V in NHL; somatic mutation. 1 PublicationCorresponds to variant dbSNP:rs28936699EnsemblClinVar.1
Gastric cancer (GASC)1 Publication
The gene represented in this entry is involved in disease pathogenesis.
Disease descriptionA malignant disease which starts in the stomach, can spread to the esophagus or the small intestine, and can extend through the stomach wall to nearby lymph nodes and organs. It also can metastasize to other parts of the body. The term gastric cancer or gastric carcinoma refers to adenocarcinoma of the stomach that accounts for most of all gastric malignant tumors. Two main histologic types are recognized, diffuse type and intestinal type carcinomas. Diffuse tumors are poorly differentiated infiltrating lesions, resulting in thickening of the stomach. In contrast, intestinal tumors are usually exophytic, often ulcerating, and associated with intestinal metaplasia of the stomach, most often observed in sporadic disease.
See also OMIM:613659
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_037428147M → T in GASC; somatic mutation; impairs CASP10-mediated apoptosis. 1 PublicationCorresponds to variant dbSNP:rs121909776EnsemblClinVar.1

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi401C → A: Abolishes proteolytic activity. 1 Publication1

Keywords - Diseasei

Disease mutation

Organism-specific databases

DisGeNET

More...
DisGeNETi
843

GeneReviews a resource of expert-authored, peer-reviewed disease descriptions.

More...
GeneReviewsi
CASP10

MalaCards human disease database

More...
MalaCardsi
CASP10
MIMi603909 phenotype
605027 phenotype
613659 phenotype

Open Targets

More...
OpenTargetsi
ENSG00000003400

Orphanet; a database dedicated to information on rare diseases and orphan drugs

More...
Orphaneti
3261 Autoimmune lymphoproliferative syndrome

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA26084

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...
ChEMBLi
CHEMBL5037

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
CASP10

Domain mapping of disease mutations (DMDM)

More...
DMDMi
12644463

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section describes a propeptide, which is a part of a protein that is cleaved during maturation or activation. Once cleaved, a propeptide generally has no independent biological function.<p><a href='/help/propep' target='_top'>More...</a></p>PropeptideiPRO_00000046441 – 219Add BLAST219
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_0000004645220 – 415Caspase-10 subunit p23/17Add BLAST196
ChainiPRO_0000004646416 – 521Caspase-10 subunit p12Add BLAST106

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Cleavage by granzyme B and autocatalytic activity generate the two active subunits.

Keywords - PTMi

Zymogen

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q92851

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q92851

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q92851

PeptideAtlas

More...
PeptideAtlasi
Q92851

PRoteomics IDEntifications database

More...
PRIDEi
Q92851

ProteomicsDB human proteome resource

More...
ProteomicsDBi
75543
75544 [Q92851-2]
75545 [Q92851-3]
75546 [Q92851-4]
75547 [Q92851-5]
75548 [Q92851-6]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q92851

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q92851

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Detectable in most tissues. Lowest expression is seen in brain, kidney, prostate, testis and colon.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000003400 Expressed in 152 organ(s), highest expression level in blood

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q92851 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q92851 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
CAB003780
HPA017059

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Heterotetramer that consists of two anti-parallel arranged heterodimers, each one formed by a 23/17 kDa (p23/17) (depending on the splicing events) and a 12 kDa (p12) subunit (By similarity). Self-associates. Interacts with FADD and CASP8. Found in a Fas signaling complex consisting of FAS, FADD, CASP8 and CASP10. Interacts with RFFL and RNF34; negatively regulate CASP10 through proteasomal degradation. Interacts with RIOK3.By similarity3 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
107293, 91 interactors

CORUM comprehensive resource of mammalian protein complexes

More...
CORUMi
Q92851

Protein interaction database and analysis system

More...
IntActi
Q92851, 22 interactors

Molecular INTeraction database

More...
MINTi
Q92851

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000286186

Chemistry databases

BindingDB database of measured binding affinities

More...
BindingDBi
Q92851

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q92851

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini19 – 97DED 1PROSITE-ProRule annotationAdd BLAST79
Domaini114 – 187DED 2PROSITE-ProRule annotationAdd BLAST74

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the peptidase C14A family.Curated

Keywords - Domaini

Repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG3573 Eukaryota
ENOG410ZQIE LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000160994

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000140947

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q92851

KEGG Orthology (KO)

More...
KOi
K04400

Identification of Orthologs from Complete Genome Data

More...
OMAi
DRKHRGH

Database of Orthologous Groups

More...
OrthoDBi
939331at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q92851

TreeFam database of animal gene trees

More...
TreeFami
TF102023

Family and domain databases

Conserved Domains Database

More...
CDDi
cd00032 CASc, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR029030 Caspase-like_dom_sf
IPR035701 Caspase_10
IPR033139 Caspase_cys_AS
IPR016129 Caspase_his_AS
IPR011029 DEATH-like_dom_sf
IPR001875 DED_dom
IPR002398 Pept_C14
IPR002138 Pept_C14_p10
IPR001309 Pept_C14_p20
IPR015917 Pept_C14A

The PANTHER Classification System

More...
PANTHERi
PTHR10454 PTHR10454, 1 hit
PTHR10454:SF26 PTHR10454:SF26, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF01335 DED, 2 hits

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00376 IL1BCENZYME

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00115 CASc, 1 hit
SM00031 DED, 2 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF47986 SSF47986, 2 hits
SSF52129 SSF52129, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS01122 CASPASE_CYS, 1 hit
PS01121 CASPASE_HIS, 1 hit
PS50207 CASPASE_P10, 1 hit
PS50208 CASPASE_P20, 1 hit
PS50168 DED, 2 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (7+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 7 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 7 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform A (identifier: Q92851-1) [UniParc]FASTAAdd to basket
Also known as: 10-A

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MKSQGQHWYS SSDKNCKVSF REKLLIIDSN LGVQDVENLK FLCIGLVPNK
60 70 80 90 100
KLEKSSSASD VFEHLLAEDL LSEEDPFFLA ELLYIIRQKK LLQHLNCTKE
110 120 130 140 150
EVERLLPTRQ RVSLFRNLLY ELSEGIDSEN LKDMIFLLKD SLPKTEMTSL
160 170 180 190 200
SFLAFLEKQG KIDEDNLTCL EDLCKTVVPK LLRNIEKYKR EKAIQIVTPP
210 220 230 240 250
VDKEAESYQG EEELVSQTDV KTFLEALPQE SWQNKHAGSN GNRATNGAPS
260 270 280 290 300
LVSRGMQGAS ANTLNSETST KRAAVYRMNR NHRGLCVIVN NHSFTSLKDR
310 320 330 340 350
QGTHKDAEIL SHVFQWLGFT VHIHNNVTKV EMEMVLQKQK CNPAHADGDC
360 370 380 390 400
FVFCILTHGR FGAVYSSDEA LIPIREIMSH FTALQCPRLA EKPKLFFIQA
410 420 430 440 450
CQGEEIQPSV SIEADALNPE QAPTSLQDSI PAEADFLLGL ATVPGYVSFR
460 470 480 490 500
HVEEGSWYIQ SLCNHLKKLV PRMLKFLEKT MEIRGRKRTV WGAKQISATS
510 520
LPTAISAQTP RPPMRRWSSV S
Length:521
Mass (Da):58,951
Last modified:January 11, 2001 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i840348AE602B8243
GO
Isoform B (identifier: Q92851-2) [UniParc]FASTAAdd to basket
Also known as: 10-B, 10-S

The sequence of this isoform differs from the canonical sequence as follows:
     229-271: Missing.
     473-521: MLKFLEKTME...PPMRRWSSVS → HEDILSILTA...FPVPLDALSL

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Show »
Length:479
Mass (Da):54,566
Checksum:i1467FD7A4EE003FF
GO
Isoform D (identifier: Q92851-4) [UniParc]FASTAAdd to basket
Also known as: 10-D, 10-L

The sequence of this isoform differs from the canonical sequence as follows:
     473-521: MLKFLEKTME...PPMRRWSSVS → HEDILSILTA...FPVPLDALSL

Show »
Length:522
Mass (Da):58,994
Checksum:i34847E07B3DFA688
GO
Isoform C (identifier: Q92851-3) [UniParc]FASTAAdd to basket
Also known as: 10-C

The sequence of this isoform differs from the canonical sequence as follows:
     241-273: GNRATNGAPSLVSRGMQGASANTLNSETSTKRA → EGSCVQDESEPQRPLCHCQQPQLYLPEGQTRNP
     274-521: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Show »
Length:273
Mass (Da):31,419
Checksum:i1146630514EE38DC
GO
Isoform 5 (identifier: Q92851-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     229-271: Missing.

Show »
Length:478
Mass (Da):54,523
Checksum:iE78035535F8EF57B
GO
Isoform 6 (identifier: Q92851-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     241-307: Missing.
     473-521: MLKFLEKTME...PPMRRWSSVS → HEDILSILTA...FPVPLDALSL

Show »
Length:455
Mass (Da):51,785
Checksum:i89037FC3EC173616
GO
Isoform 7 (identifier: Q92851-7) [UniParc]FASTAAdd to basket
Also known as: 10-G, 10g

The sequence of this isoform differs from the canonical sequence as follows:
     229-247: QESWQNKHAGSNGNRATNG → EGVFVFLNEGDRGNSPDDL
     248-521: Missing.

Show »
Length:247
Mass (Da):28,364
Checksum:i52370B5AD12C4DCF
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
B4E3T5B4E3T5_HUMAN
Caspase-10
CASP10
118Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti68E → G in AAB46730 (PubMed:9045686).Curated1
Sequence conflicti268T → A in AAD28403 (PubMed:10187817).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_06523314K → T Found in a colon cancer sample; somatic mutation. 1 Publication1
Natural variantiVAR_06523421R → C Found in a multiple myeloma sample; somatic mutation. 1 PublicationCorresponds to variant dbSNP:rs559979934Ensembl.1
Natural variantiVAR_037428147M → T in GASC; somatic mutation; impairs CASP10-mediated apoptosis. 1 PublicationCorresponds to variant dbSNP:rs121909776EnsemblClinVar.1
Natural variantiVAR_055361239S → C. Corresponds to variant dbSNP:rs41473647EnsemblClinVar.1
Natural variantiVAR_014071285L → F in ALPS2A. 1 PublicationCorresponds to variant dbSNP:rs17860403EnsemblClinVar.1
Natural variantiVAR_065235285L → P Found in a T-acute lymphoblastic leukemia sample; somatic mutation. 1 Publication1
Natural variantiVAR_037429406I → L Functional polymorphism; the mutant protein has defective apoptosis and exerts a dominant-negative effect when cotransfected with the wild-type protein. 3 PublicationsCorresponds to variant dbSNP:rs80358239EnsemblClinVar.1
Natural variantiVAR_014072410V → I Does not interfere with apoptosis in a dominant negative manner. 3 PublicationsCorresponds to variant dbSNP:rs13010627EnsemblClinVar.1
Natural variantiVAR_037430414A → V in NHL; somatic mutation. 1 PublicationCorresponds to variant dbSNP:rs28936699EnsemblClinVar.1
Natural variantiVAR_055362444P → S. Corresponds to variant dbSNP:rs41513147Ensembl.1
Natural variantiVAR_037431446Y → C Associated with ALPS2A; does not interfere with apoptosis in a dominant negative manner. 1 PublicationCorresponds to variant dbSNP:rs17860405EnsemblClinVar.1
Isoform 6 (identifier: Q92851-6)
Natural varianti455L → I. Corresponds to variant dbSNP:rs13006529Ensembl.1
Isoform B (identifier: Q92851-2)
Natural varianti479L → I. Corresponds to variant dbSNP:rs13006529Ensembl.1
Isoform D (identifier: Q92851-4)
Natural varianti522L → I Not associated with significantly altered cutaneous melanoma risk. Corresponds to variant dbSNP:rs13006529Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_000819229 – 271Missing in isoform B and isoform 5. 2 PublicationsAdd BLAST43
Alternative sequenceiVSP_053333229 – 247QESWQ…RATNG → EGVFVFLNEGDRGNSPDDL in isoform 7. 1 PublicationAdd BLAST19
Alternative sequenceiVSP_037229241 – 307Missing in isoform 6. 1 PublicationAdd BLAST67
Alternative sequenceiVSP_000821241 – 273GNRAT…STKRA → EGSCVQDESEPQRPLCHCQQ PQLYLPEGQTRNP in isoform C. 1 PublicationAdd BLAST33
Alternative sequenceiVSP_053334248 – 521Missing in isoform 7. 1 PublicationAdd BLAST274
Alternative sequenceiVSP_000822274 – 521Missing in isoform C. 1 PublicationAdd BLAST248
Alternative sequenceiVSP_000820473 – 521MLKFL…WSSVS → HEDILSILTAVNDDVSRRVD KQGTKKQMPQPAFTLRKKLV FPVPLDALSL in isoform B, isoform D and isoform 6. 4 PublicationsAdd BLAST49

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
U60519 mRNA Translation: AAC50644.1
U86214 mRNA Translation: AAB46730.1
AF111344 mRNA Translation: AAD28402.1
AF111345 mRNA Translation: AAD28403.1
AB038979 Genomic DNA Translation: BAB32553.1
AB038979 Genomic DNA Translation: BAB32554.1
AJ487678 mRNA Translation: CAD32371.1
AJ487679 mRNA Translation: CAD32372.1
AY690601 mRNA Translation: AAU00989.1
EF050529 Genomic DNA Translation: ABJ53426.1
AC007283 Genomic DNA Translation: AAY24291.1
CH471063 Genomic DNA Translation: EAW70248.1
CH471063 Genomic DNA Translation: EAW70249.1
BC042844 mRNA Translation: AAH42844.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS2338.1 [Q92851-1]
CCDS2339.1 [Q92851-2]
CCDS2340.1 [Q92851-4]
CCDS56159.1 [Q92851-6]
CCDS56160.1 [Q92851-5]
CCDS77506.1 [Q92851-7]

NCBI Reference Sequences

More...
RefSeqi
NP_001193453.1, NM_001206524.1 [Q92851-6]
NP_001193471.1, NM_001206542.1 [Q92851-5]
NP_001221.2, NM_001230.4 [Q92851-2]
NP_001293012.1, NM_001306083.1 [Q92851-7]
NP_116756.2, NM_032974.4 [Q92851-1]
NP_116758.1, NM_032976.3 [Q92851-3]
NP_116759.2, NM_032977.3 [Q92851-4]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000272879; ENSP00000272879; ENSG00000003400 [Q92851-1]
ENST00000286186; ENSP00000286186; ENSG00000003400 [Q92851-4]
ENST00000313728; ENSP00000314599; ENSG00000003400 [Q92851-6]
ENST00000346817; ENSP00000237865; ENSG00000003400 [Q92851-2]
ENST00000360132; ENSP00000353250; ENSG00000003400 [Q92851-3]
ENST00000374650; ENSP00000363781; ENSG00000003400 [Q92851-7]
ENST00000448480; ENSP00000396835; ENSG00000003400 [Q92851-5]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
843

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:843

UCSC genome browser

More...
UCSCi
uc002uxi.2 human [Q92851-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross_references_section">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

CASP10base

CASP10 mutation db

Autoimmune Lymphoproliferative Syndrome Database (ALPSbase)

Caspase-10 mutations causing ALPS type II

NIEHS-SNPs

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U60519 mRNA Translation: AAC50644.1
U86214 mRNA Translation: AAB46730.1
AF111344 mRNA Translation: AAD28402.1
AF111345 mRNA Translation: AAD28403.1
AB038979 Genomic DNA Translation: BAB32553.1
AB038979 Genomic DNA Translation: BAB32554.1
AJ487678 mRNA Translation: CAD32371.1
AJ487679 mRNA Translation: CAD32372.1
AY690601 mRNA Translation: AAU00989.1
EF050529 Genomic DNA Translation: ABJ53426.1
AC007283 Genomic DNA Translation: AAY24291.1
CH471063 Genomic DNA Translation: EAW70248.1
CH471063 Genomic DNA Translation: EAW70249.1
BC042844 mRNA Translation: AAH42844.1
CCDSiCCDS2338.1 [Q92851-1]
CCDS2339.1 [Q92851-2]
CCDS2340.1 [Q92851-4]
CCDS56159.1 [Q92851-6]
CCDS56160.1 [Q92851-5]
CCDS77506.1 [Q92851-7]
RefSeqiNP_001193453.1, NM_001206524.1 [Q92851-6]
NP_001193471.1, NM_001206542.1 [Q92851-5]
NP_001221.2, NM_001230.4 [Q92851-2]
NP_001293012.1, NM_001306083.1 [Q92851-7]
NP_116756.2, NM_032974.4 [Q92851-1]
NP_116758.1, NM_032976.3 [Q92851-3]
NP_116759.2, NM_032977.3 [Q92851-4]

3D structure databases

SMRiQ92851
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi107293, 91 interactors
CORUMiQ92851
IntActiQ92851, 22 interactors
MINTiQ92851
STRINGi9606.ENSP00000286186

Chemistry databases

BindingDBiQ92851
ChEMBLiCHEMBL5037

Protein family/group databases

MEROPSiC14.011

PTM databases

iPTMnetiQ92851
PhosphoSitePlusiQ92851

Polymorphism and mutation databases

BioMutaiCASP10
DMDMi12644463

Proteomic databases

jPOSTiQ92851
MaxQBiQ92851
PaxDbiQ92851
PeptideAtlasiQ92851
PRIDEiQ92851
ProteomicsDBi75543
75544 [Q92851-2]
75545 [Q92851-3]
75546 [Q92851-4]
75547 [Q92851-5]
75548 [Q92851-6]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000272879; ENSP00000272879; ENSG00000003400 [Q92851-1]
ENST00000286186; ENSP00000286186; ENSG00000003400 [Q92851-4]
ENST00000313728; ENSP00000314599; ENSG00000003400 [Q92851-6]
ENST00000346817; ENSP00000237865; ENSG00000003400 [Q92851-2]
ENST00000360132; ENSP00000353250; ENSG00000003400 [Q92851-3]
ENST00000374650; ENSP00000363781; ENSG00000003400 [Q92851-7]
ENST00000448480; ENSP00000396835; ENSG00000003400 [Q92851-5]
GeneIDi843
KEGGihsa:843
UCSCiuc002uxi.2 human [Q92851-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
843
DisGeNETi843

GeneCards: human genes, protein and diseases

More...
GeneCardsi
CASP10
GeneReviewsiCASP10
HGNCiHGNC:1500 CASP10
HPAiCAB003780
HPA017059
MalaCardsiCASP10
MIMi601762 gene
603909 phenotype
605027 phenotype
613659 phenotype
neXtProtiNX_Q92851
OpenTargetsiENSG00000003400
Orphaneti3261 Autoimmune lymphoproliferative syndrome
PharmGKBiPA26084

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG3573 Eukaryota
ENOG410ZQIE LUCA
GeneTreeiENSGT00940000160994
HOGENOMiHOG000140947
InParanoidiQ92851
KOiK04400
OMAiDRKHRGH
OrthoDBi939331at2759
PhylomeDBiQ92851
TreeFamiTF102023

Enzyme and pathway databases

BRENDAi3.4.22.63 2681
ReactomeiR-HSA-6803207 TP53 Regulates Transcription of Caspase Activators and Caspases
R-HSA-75157 FasL/ CD95L signaling
R-HSA-75158 TRAIL signaling
R-HSA-933543 NF-kB activation through FADD/RIP-1 pathway mediated by caspase-8 and -10
SIGNORiQ92851

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
CASP10 human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
Caspase_10

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
843

Protein Ontology

More...
PROi
PR:Q92851

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000003400 Expressed in 152 organ(s), highest expression level in blood
ExpressionAtlasiQ92851 baseline and differential
GenevisibleiQ92851 HS

Family and domain databases

CDDicd00032 CASc, 1 hit
InterProiView protein in InterPro
IPR029030 Caspase-like_dom_sf
IPR035701 Caspase_10
IPR033139 Caspase_cys_AS
IPR016129 Caspase_his_AS
IPR011029 DEATH-like_dom_sf
IPR001875 DED_dom
IPR002398 Pept_C14
IPR002138 Pept_C14_p10
IPR001309 Pept_C14_p20
IPR015917 Pept_C14A
PANTHERiPTHR10454 PTHR10454, 1 hit
PTHR10454:SF26 PTHR10454:SF26, 1 hit
PfamiView protein in Pfam
PF01335 DED, 2 hits
PRINTSiPR00376 IL1BCENZYME
SMARTiView protein in SMART
SM00115 CASc, 1 hit
SM00031 DED, 2 hits
SUPFAMiSSF47986 SSF47986, 2 hits
SSF52129 SSF52129, 1 hit
PROSITEiView protein in PROSITE
PS01122 CASPASE_CYS, 1 hit
PS01121 CASPASE_HIS, 1 hit
PS50207 CASPASE_P10, 1 hit
PS50208 CASPASE_P20, 1 hit
PS50168 DED, 2 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiCASPA_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q92851
Secondary accession number(s): Q68HC0
, Q6KF62, Q6KF63, Q8IUP5, Q8WYQ8, Q99845, Q9Y2U6, Q9Y2U7
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: January 11, 2001
Last modified: May 8, 2019
This is version 205 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. Peptidase families
    Classification of peptidase families and list of entries
  6. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again