Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Caspase-10

Gene

CASP10

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Involved in the activation cascade of caspases responsible for apoptosis execution. Recruited to both Fas- and TNFR-1 receptors in a FADD dependent manner. May participate in the granzyme B apoptotic pathways. Cleaves and activates caspase-3, -4, -6, -7, -8, and -9. Hydrolyzes the small- molecule substrates, Tyr-Val-Ala-Asp-|-AMC and Asp-Glu-Val-Asp-|-AMC.1 Publication
Isoform 7 can enhance NF-kappaB activity but promotes only slight apoptosis.1 Publication
Isoform C is proteolytically inactive.1 Publication

Catalytic activityi

Strict requirement for Asp at position P1 and has a preferred cleavage sequence of Leu-Gln-Thr-Asp-|-Gly.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Active sitei358By similarity1
Active sitei401By similarity1

GO - Molecular functioni

  • cysteine-type endopeptidase activity Source: UniProtKB
  • cysteine-type endopeptidase activity involved in apoptotic process Source: GO_Central
  • cysteine-type endopeptidase activity involved in apoptotic signaling pathway Source: UniProtKB
  • death effector domain binding Source: UniProtKB
  • ubiquitin protein ligase binding Source: UniProtKB

GO - Biological processi

Keywordsi

Molecular functionHydrolase, Protease, Thiol protease
Biological processApoptosis

Enzyme and pathway databases

BRENDAi3.4.22.63 2681
ReactomeiR-HSA-6803207 TP53 Regulates Transcription of Caspase Activators and Caspases
R-HSA-75157 FasL/ CD95L signaling
R-HSA-75158 TRAIL signaling
R-HSA-933543 NF-kB activation through FADD/RIP-1 pathway mediated by caspase-8 and -10
SIGNORiQ92851

Protein family/group databases

MEROPSiC14.011

Names & Taxonomyi

Protein namesi
Recommended name:
Caspase-10 (EC:3.4.22.63)
Short name:
CASP-10
Alternative name(s):
Apoptotic protease Mch-4
FAS-associated death domain protein interleukin-1B-converting enzyme 2
Short name:
FLICE2
ICE-like apoptotic protease 4
Cleaved into the following 2 chains:
Gene namesi
Name:CASP10
Synonyms:MCH4
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 2

Organism-specific databases

EuPathDBiHostDB:ENSG00000003400.14
HGNCiHGNC:1500 CASP10
MIMi601762 gene
neXtProtiNX_Q92851

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Pathology & Biotechi

Involvement in diseasei

Autoimmune lymphoproliferative syndrome 2A (ALPS2A)1 Publication
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionA disorder of apoptosis that manifests in early childhood and results in the accumulation of autoreactive lymphocytes. It is characterized by non-malignant lymphadenopathy with hepatosplenomegaly, and autoimmune hemolytic anemia, thrombocytopenia and neutropenia.
See also OMIM:603909
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_014071285L → F in ALPS2A. 1 PublicationCorresponds to variant dbSNP:rs17860403EnsemblClinVar.1
Familial non-Hodgkin lymphoma (NHL)1 Publication
The gene represented in this entry is involved in disease pathogenesis.
Disease descriptionCancer that starts in cells of the lymph system, which is part of the body's immune system. NHLs can occur at any age and are often marked by enlarged lymph nodes, fever and weight loss.
See also OMIM:605027
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_037430414A → V in NHL; somatic mutation. 1 PublicationCorresponds to variant dbSNP:rs28936699EnsemblClinVar.1
Gastric cancer (GASC)1 Publication
The gene represented in this entry is involved in disease pathogenesis.
Disease descriptionA malignant disease which starts in the stomach, can spread to the esophagus or the small intestine, and can extend through the stomach wall to nearby lymph nodes and organs. It also can metastasize to other parts of the body. The term gastric cancer or gastric carcinoma refers to adenocarcinoma of the stomach that accounts for most of all gastric malignant tumors. Two main histologic types are recognized, diffuse type and intestinal type carcinomas. Diffuse tumors are poorly differentiated infiltrating lesions, resulting in thickening of the stomach. In contrast, intestinal tumors are usually exophytic, often ulcerating, and associated with intestinal metaplasia of the stomach, most often observed in sporadic disease.
See also OMIM:613659
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_037428147M → T in GASC; somatic mutation; impairs CASP10-mediated apoptosis. 1 PublicationCorresponds to variant dbSNP:rs121909776EnsemblClinVar.1

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi401C → A: Abolishes proteolytic activity. 1 Publication1

Keywords - Diseasei

Disease mutation

Organism-specific databases

DisGeNETi843
GeneReviewsiCASP10
MalaCardsiCASP10
MIMi603909 phenotype
605027 phenotype
613659 phenotype
OpenTargetsiENSG00000003400
Orphaneti3261 Autoimmune lymphoproliferative syndrome
PharmGKBiPA26084

Chemistry databases

ChEMBLiCHEMBL5037

Polymorphism and mutation databases

BioMutaiCASP10
DMDMi12644463

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
PropeptideiPRO_00000046441 – 219Add BLAST219
ChainiPRO_0000004645220 – 415Caspase-10 subunit p23/17Add BLAST196
ChainiPRO_0000004646416 – 521Caspase-10 subunit p12Add BLAST106

Post-translational modificationi

Cleavage by granzyme B and autocatalytic activity generate the two active subunits.

Keywords - PTMi

Zymogen

Proteomic databases

MaxQBiQ92851
PaxDbiQ92851
PeptideAtlasiQ92851
PRIDEiQ92851
ProteomicsDBi75543
75544 [Q92851-2]
75545 [Q92851-3]
75546 [Q92851-4]
75547 [Q92851-5]
75548 [Q92851-6]

PTM databases

iPTMnetiQ92851
PhosphoSitePlusiQ92851

Expressioni

Tissue specificityi

Detectable in most tissues. Lowest expression is seen in brain, kidney, prostate, testis and colon.

Gene expression databases

BgeeiENSG00000003400 Expressed in 152 organ(s), highest expression level in blood
CleanExiHS_CASP10
ExpressionAtlasiQ92851 baseline and differential
GenevisibleiQ92851 HS

Organism-specific databases

HPAiCAB003780
HPA017059

Interactioni

Subunit structurei

Heterotetramer that consists of two anti-parallel arranged heterodimers, each one formed by a 23/17 kDa (p23/17) (depending on the splicing events) and a 12 kDa (p12) subunit (By similarity). Self-associates. Interacts with FADD and CASP8. Found in a Fas signaling complex consisting of FAS, FADD, CASP8 and CASP10. Interacts with RFFL and RNF34; negatively regulate CASP10 through proteasomal degradation. Interacts with RIOK3.By similarity3 Publications

Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

BioGridi107293, 91 interactors
CORUMiQ92851
IntActiQ92851, 22 interactors
MINTiQ92851
STRINGi9606.ENSP00000286186

Chemistry databases

BindingDBiQ92851

Structurei

3D structure databases

ProteinModelPortaliQ92851
SMRiQ92851
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini19 – 97DED 1PROSITE-ProRule annotationAdd BLAST79
Domaini114 – 187DED 2PROSITE-ProRule annotationAdd BLAST74

Sequence similaritiesi

Belongs to the peptidase C14A family.Curated

Keywords - Domaini

Repeat

Phylogenomic databases

eggNOGiKOG3573 Eukaryota
ENOG410ZQIE LUCA
GeneTreeiENSGT00760000118912
HOGENOMiHOG000140947
HOVERGENiHBG050803
InParanoidiQ92851
KOiK04400
OMAiGHADGDC
OrthoDBiEOG091G05YD
PhylomeDBiQ92851
TreeFamiTF102023

Family and domain databases

CDDicd00032 CASc, 1 hit
InterProiView protein in InterPro
IPR029030 Caspase-like_dom_sf
IPR035701 Caspase_10
IPR033139 Caspase_cys_AS
IPR016129 Caspase_his_AS
IPR011029 DEATH-like_dom_sf
IPR001875 DED_dom
IPR002398 Pept_C14
IPR002138 Pept_C14_p10
IPR001309 Pept_C14_p20
IPR015917 Pept_C14A
PANTHERiPTHR10454 PTHR10454, 1 hit
PTHR10454:SF26 PTHR10454:SF26, 1 hit
PfamiView protein in Pfam
PF01335 DED, 2 hits
PRINTSiPR00376 IL1BCENZYME
SMARTiView protein in SMART
SM00115 CASc, 1 hit
SM00031 DED, 2 hits
SUPFAMiSSF47986 SSF47986, 2 hits
SSF52129 SSF52129, 1 hit
PROSITEiView protein in PROSITE
PS01122 CASPASE_CYS, 1 hit
PS01121 CASPASE_HIS, 1 hit
PS50207 CASPASE_P10, 1 hit
PS50208 CASPASE_P20, 1 hit
PS50168 DED, 2 hits

Sequences (7+)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 7 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 7 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform A (identifier: Q92851-1) [UniParc]FASTAAdd to basket
Also known as: 10-A

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MKSQGQHWYS SSDKNCKVSF REKLLIIDSN LGVQDVENLK FLCIGLVPNK
60 70 80 90 100
KLEKSSSASD VFEHLLAEDL LSEEDPFFLA ELLYIIRQKK LLQHLNCTKE
110 120 130 140 150
EVERLLPTRQ RVSLFRNLLY ELSEGIDSEN LKDMIFLLKD SLPKTEMTSL
160 170 180 190 200
SFLAFLEKQG KIDEDNLTCL EDLCKTVVPK LLRNIEKYKR EKAIQIVTPP
210 220 230 240 250
VDKEAESYQG EEELVSQTDV KTFLEALPQE SWQNKHAGSN GNRATNGAPS
260 270 280 290 300
LVSRGMQGAS ANTLNSETST KRAAVYRMNR NHRGLCVIVN NHSFTSLKDR
310 320 330 340 350
QGTHKDAEIL SHVFQWLGFT VHIHNNVTKV EMEMVLQKQK CNPAHADGDC
360 370 380 390 400
FVFCILTHGR FGAVYSSDEA LIPIREIMSH FTALQCPRLA EKPKLFFIQA
410 420 430 440 450
CQGEEIQPSV SIEADALNPE QAPTSLQDSI PAEADFLLGL ATVPGYVSFR
460 470 480 490 500
HVEEGSWYIQ SLCNHLKKLV PRMLKFLEKT MEIRGRKRTV WGAKQISATS
510 520
LPTAISAQTP RPPMRRWSSV S
Length:521
Mass (Da):58,951
Last modified:January 11, 2001 - v3
Checksum:i840348AE602B8243
GO
Isoform B (identifier: Q92851-2) [UniParc]FASTAAdd to basket
Also known as: 10-B, 10-S

The sequence of this isoform differs from the canonical sequence as follows:
     229-271: Missing.
     473-521: MLKFLEKTME...PPMRRWSSVS → HEDILSILTA...FPVPLDALSL

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Show »
Length:479
Mass (Da):54,566
Checksum:i1467FD7A4EE003FF
GO
Isoform D (identifier: Q92851-4) [UniParc]FASTAAdd to basket
Also known as: 10-D, 10-L

The sequence of this isoform differs from the canonical sequence as follows:
     473-521: MLKFLEKTME...PPMRRWSSVS → HEDILSILTA...FPVPLDALSL

Show »
Length:522
Mass (Da):58,994
Checksum:i34847E07B3DFA688
GO
Isoform C (identifier: Q92851-3) [UniParc]FASTAAdd to basket
Also known as: 10-C

The sequence of this isoform differs from the canonical sequence as follows:
     241-273: GNRATNGAPSLVSRGMQGASANTLNSETSTKRA → EGSCVQDESEPQRPLCHCQQPQLYLPEGQTRNP
     274-521: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Show »
Length:273
Mass (Da):31,419
Checksum:i1146630514EE38DC
GO
Isoform 5 (identifier: Q92851-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     229-271: Missing.

Show »
Length:478
Mass (Da):54,523
Checksum:iE78035535F8EF57B
GO
Isoform 6 (identifier: Q92851-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     241-307: Missing.
     473-521: MLKFLEKTME...PPMRRWSSVS → HEDILSILTA...FPVPLDALSL

Show »
Length:455
Mass (Da):51,785
Checksum:i89037FC3EC173616
GO
Isoform 7 (identifier: Q92851-7) [UniParc]FASTAAdd to basket
Also known as: 10-G, 10g

The sequence of this isoform differs from the canonical sequence as follows:
     229-247: QESWQNKHAGSNGNRATNG → EGVFVFLNEGDRGNSPDDL
     248-521: Missing.

Show »
Length:247
Mass (Da):28,364
Checksum:i52370B5AD12C4DCF
GO

Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
B4E3T5B4E3T5_HUMAN
Caspase-10
CASP10
118Annotation score:

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti68E → G in AAB46730 (PubMed:9045686).Curated1
Sequence conflicti268T → A in AAD28403 (PubMed:10187817).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_06523314K → T Found in a colon cancer sample; somatic mutation. 1 Publication1
Natural variantiVAR_06523421R → C Found in a multiple myeloma sample; somatic mutation. 1 PublicationCorresponds to variant dbSNP:rs559979934Ensembl.1
Natural variantiVAR_037428147M → T in GASC; somatic mutation; impairs CASP10-mediated apoptosis. 1 PublicationCorresponds to variant dbSNP:rs121909776EnsemblClinVar.1
Natural variantiVAR_055361239S → C. Corresponds to variant dbSNP:rs41473647EnsemblClinVar.1
Natural variantiVAR_014071285L → F in ALPS2A. 1 PublicationCorresponds to variant dbSNP:rs17860403EnsemblClinVar.1
Natural variantiVAR_065235285L → P Found in a T-acute lymphoblastic leukemia sample; somatic mutation. 1 Publication1
Natural variantiVAR_037429406I → L Functional polymorphism; the mutant protein has defective apoptosis and exerts a dominant-negative effect when cotransfected with the wild-type protein. 3 PublicationsCorresponds to variant dbSNP:rs80358239EnsemblClinVar.1
Natural variantiVAR_014072410V → I Does not interfere with apoptosis in a dominant negative manner. 3 PublicationsCorresponds to variant dbSNP:rs13010627EnsemblClinVar.1
Natural variantiVAR_037430414A → V in NHL; somatic mutation. 1 PublicationCorresponds to variant dbSNP:rs28936699EnsemblClinVar.1
Natural variantiVAR_055362444P → S. Corresponds to variant dbSNP:rs41513147Ensembl.1
Natural variantiVAR_037431446Y → C Associated with ALPS2A; does not interfere with apoptosis in a dominant negative manner. 1 PublicationCorresponds to variant dbSNP:rs17860405EnsemblClinVar.1
Isoform 6 (identifier: Q92851-6)
Natural varianti455L → I. Corresponds to variant dbSNP:rs13006529Ensembl.1
Isoform B (identifier: Q92851-2)
Natural varianti479L → I. Corresponds to variant dbSNP:rs13006529Ensembl.1
Isoform D (identifier: Q92851-4)
Natural varianti522L → I Not associated with significantly altered cutaneous melanoma risk. Corresponds to variant dbSNP:rs13006529Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_000819229 – 271Missing in isoform B and isoform 5. 2 PublicationsAdd BLAST43
Alternative sequenceiVSP_053333229 – 247QESWQ…RATNG → EGVFVFLNEGDRGNSPDDL in isoform 7. 1 PublicationAdd BLAST19
Alternative sequenceiVSP_037229241 – 307Missing in isoform 6. 1 PublicationAdd BLAST67
Alternative sequenceiVSP_000821241 – 273GNRAT…STKRA → EGSCVQDESEPQRPLCHCQQ PQLYLPEGQTRNP in isoform C. 1 PublicationAdd BLAST33
Alternative sequenceiVSP_053334248 – 521Missing in isoform 7. 1 PublicationAdd BLAST274
Alternative sequenceiVSP_000822274 – 521Missing in isoform C. 1 PublicationAdd BLAST248
Alternative sequenceiVSP_000820473 – 521MLKFL…WSSVS → HEDILSILTAVNDDVSRRVD KQGTKKQMPQPAFTLRKKLV FPVPLDALSL in isoform B, isoform D and isoform 6. 4 PublicationsAdd BLAST49

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U60519 mRNA Translation: AAC50644.1
U86214 mRNA Translation: AAB46730.1
AF111344 mRNA Translation: AAD28402.1
AF111345 mRNA Translation: AAD28403.1
AB038979 Genomic DNA Translation: BAB32553.1
AB038979 Genomic DNA Translation: BAB32554.1
AJ487678 mRNA Translation: CAD32371.1
AJ487679 mRNA Translation: CAD32372.1
AY690601 mRNA Translation: AAU00989.1
EF050529 Genomic DNA Translation: ABJ53426.1
AC007283 Genomic DNA Translation: AAY24291.1
CH471063 Genomic DNA Translation: EAW70248.1
CH471063 Genomic DNA Translation: EAW70249.1
BC042844 mRNA Translation: AAH42844.1
CCDSiCCDS2338.1 [Q92851-1]
CCDS2339.1 [Q92851-2]
CCDS2340.1 [Q92851-4]
CCDS56159.1 [Q92851-6]
CCDS56160.1 [Q92851-5]
CCDS77506.1 [Q92851-7]
RefSeqiNP_001193453.1, NM_001206524.1 [Q92851-6]
NP_001193471.1, NM_001206542.1 [Q92851-5]
NP_001221.2, NM_001230.4 [Q92851-2]
NP_001293012.1, NM_001306083.1 [Q92851-7]
NP_116756.2, NM_032974.4 [Q92851-1]
NP_116758.1, NM_032976.3 [Q92851-3]
NP_116759.2, NM_032977.3 [Q92851-4]
UniGeneiHs.5353

Genome annotation databases

EnsembliENST00000272879; ENSP00000272879; ENSG00000003400 [Q92851-1]
ENST00000286186; ENSP00000286186; ENSG00000003400 [Q92851-4]
ENST00000313728; ENSP00000314599; ENSG00000003400 [Q92851-6]
ENST00000346817; ENSP00000237865; ENSG00000003400 [Q92851-2]
ENST00000360132; ENSP00000353250; ENSG00000003400 [Q92851-3]
ENST00000374650; ENSP00000363781; ENSG00000003400 [Q92851-7]
ENST00000448480; ENSP00000396835; ENSG00000003400 [Q92851-5]
GeneIDi843
KEGGihsa:843
UCSCiuc002uxi.2 human [Q92851-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Web resourcesi

CASP10base

CASP10 mutation db

Autoimmune Lymphoproliferative Syndrome Database (ALPSbase)

Caspase-10 mutations causing ALPS type II

NIEHS-SNPs

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U60519 mRNA Translation: AAC50644.1
U86214 mRNA Translation: AAB46730.1
AF111344 mRNA Translation: AAD28402.1
AF111345 mRNA Translation: AAD28403.1
AB038979 Genomic DNA Translation: BAB32553.1
AB038979 Genomic DNA Translation: BAB32554.1
AJ487678 mRNA Translation: CAD32371.1
AJ487679 mRNA Translation: CAD32372.1
AY690601 mRNA Translation: AAU00989.1
EF050529 Genomic DNA Translation: ABJ53426.1
AC007283 Genomic DNA Translation: AAY24291.1
CH471063 Genomic DNA Translation: EAW70248.1
CH471063 Genomic DNA Translation: EAW70249.1
BC042844 mRNA Translation: AAH42844.1
CCDSiCCDS2338.1 [Q92851-1]
CCDS2339.1 [Q92851-2]
CCDS2340.1 [Q92851-4]
CCDS56159.1 [Q92851-6]
CCDS56160.1 [Q92851-5]
CCDS77506.1 [Q92851-7]
RefSeqiNP_001193453.1, NM_001206524.1 [Q92851-6]
NP_001193471.1, NM_001206542.1 [Q92851-5]
NP_001221.2, NM_001230.4 [Q92851-2]
NP_001293012.1, NM_001306083.1 [Q92851-7]
NP_116756.2, NM_032974.4 [Q92851-1]
NP_116758.1, NM_032976.3 [Q92851-3]
NP_116759.2, NM_032977.3 [Q92851-4]
UniGeneiHs.5353

3D structure databases

ProteinModelPortaliQ92851
SMRiQ92851
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi107293, 91 interactors
CORUMiQ92851
IntActiQ92851, 22 interactors
MINTiQ92851
STRINGi9606.ENSP00000286186

Chemistry databases

BindingDBiQ92851
ChEMBLiCHEMBL5037

Protein family/group databases

MEROPSiC14.011

PTM databases

iPTMnetiQ92851
PhosphoSitePlusiQ92851

Polymorphism and mutation databases

BioMutaiCASP10
DMDMi12644463

Proteomic databases

MaxQBiQ92851
PaxDbiQ92851
PeptideAtlasiQ92851
PRIDEiQ92851
ProteomicsDBi75543
75544 [Q92851-2]
75545 [Q92851-3]
75546 [Q92851-4]
75547 [Q92851-5]
75548 [Q92851-6]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000272879; ENSP00000272879; ENSG00000003400 [Q92851-1]
ENST00000286186; ENSP00000286186; ENSG00000003400 [Q92851-4]
ENST00000313728; ENSP00000314599; ENSG00000003400 [Q92851-6]
ENST00000346817; ENSP00000237865; ENSG00000003400 [Q92851-2]
ENST00000360132; ENSP00000353250; ENSG00000003400 [Q92851-3]
ENST00000374650; ENSP00000363781; ENSG00000003400 [Q92851-7]
ENST00000448480; ENSP00000396835; ENSG00000003400 [Q92851-5]
GeneIDi843
KEGGihsa:843
UCSCiuc002uxi.2 human [Q92851-1]

Organism-specific databases

CTDi843
DisGeNETi843
EuPathDBiHostDB:ENSG00000003400.14
GeneCardsiCASP10
GeneReviewsiCASP10
HGNCiHGNC:1500 CASP10
HPAiCAB003780
HPA017059
MalaCardsiCASP10
MIMi601762 gene
603909 phenotype
605027 phenotype
613659 phenotype
neXtProtiNX_Q92851
OpenTargetsiENSG00000003400
Orphaneti3261 Autoimmune lymphoproliferative syndrome
PharmGKBiPA26084
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG3573 Eukaryota
ENOG410ZQIE LUCA
GeneTreeiENSGT00760000118912
HOGENOMiHOG000140947
HOVERGENiHBG050803
InParanoidiQ92851
KOiK04400
OMAiGHADGDC
OrthoDBiEOG091G05YD
PhylomeDBiQ92851
TreeFamiTF102023

Enzyme and pathway databases

BRENDAi3.4.22.63 2681
ReactomeiR-HSA-6803207 TP53 Regulates Transcription of Caspase Activators and Caspases
R-HSA-75157 FasL/ CD95L signaling
R-HSA-75158 TRAIL signaling
R-HSA-933543 NF-kB activation through FADD/RIP-1 pathway mediated by caspase-8 and -10
SIGNORiQ92851

Miscellaneous databases

ChiTaRSiCASP10 human
GeneWikiiCaspase_10
GenomeRNAii843
PROiPR:Q92851
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000003400 Expressed in 152 organ(s), highest expression level in blood
CleanExiHS_CASP10
ExpressionAtlasiQ92851 baseline and differential
GenevisibleiQ92851 HS

Family and domain databases

CDDicd00032 CASc, 1 hit
InterProiView protein in InterPro
IPR029030 Caspase-like_dom_sf
IPR035701 Caspase_10
IPR033139 Caspase_cys_AS
IPR016129 Caspase_his_AS
IPR011029 DEATH-like_dom_sf
IPR001875 DED_dom
IPR002398 Pept_C14
IPR002138 Pept_C14_p10
IPR001309 Pept_C14_p20
IPR015917 Pept_C14A
PANTHERiPTHR10454 PTHR10454, 1 hit
PTHR10454:SF26 PTHR10454:SF26, 1 hit
PfamiView protein in Pfam
PF01335 DED, 2 hits
PRINTSiPR00376 IL1BCENZYME
SMARTiView protein in SMART
SM00115 CASc, 1 hit
SM00031 DED, 2 hits
SUPFAMiSSF47986 SSF47986, 2 hits
SSF52129 SSF52129, 1 hit
PROSITEiView protein in PROSITE
PS01122 CASPASE_CYS, 1 hit
PS01121 CASPASE_HIS, 1 hit
PS50207 CASPASE_P10, 1 hit
PS50208 CASPASE_P20, 1 hit
PS50168 DED, 2 hits
ProtoNetiSearch...

Entry informationi

Entry nameiCASPA_HUMAN
AccessioniPrimary (citable) accession number: Q92851
Secondary accession number(s): Q68HC0
, Q6KF62, Q6KF63, Q8IUP5, Q8WYQ8, Q99845, Q9Y2U6, Q9Y2U7
Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: January 11, 2001
Last modified: November 7, 2018
This is version 201 of the entry and version 3 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Peptidase families
    Classification of peptidase families and list of entries
  5. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  6. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again