Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Kinesin-associated protein 3

Gene

KIFAP3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Involved in tethering the chromosomes to the spindle pole and in chromosome movement. Binds to the tail domain of the KIF3A/KIF3B heterodimer to form a heterotrimeric KIF3 complex and may regulate the membrane binding of this complex (By similarity).By similarity

GO - Molecular functioni

  • intraciliary transport particle B binding Source: Ensembl
  • kinesin binding Source: BHF-UCL
  • protein phosphatase binding Source: BHF-UCL

GO - Biological processi

Enzyme and pathway databases

ReactomeiR-HSA-1445148 Translocation of SLC2A4 (GLUT4) to the plasma membrane
R-HSA-2132295 MHC class II antigen presentation
R-HSA-5620924 Intraflagellar transport
R-HSA-6811434 COPI-dependent Golgi-to-ER retrograde traffic
R-HSA-983189 Kinesins
SignaLinkiQ92845

Names & Taxonomyi

Protein namesi
Recommended name:
Kinesin-associated protein 3
Short name:
KAP-3
Short name:
KAP3
Alternative name(s):
Smg GDS-associated protein
Gene namesi
Name:KIFAP3
Synonyms:KIF3AP, SMAP
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 1

Organism-specific databases

EuPathDBiHostDB:ENSG00000075945.12
HGNCiHGNC:17060 KIFAP3
MIMi601836 gene
neXtProtiNX_Q92845

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Pathology & Biotechi

Organism-specific databases

DisGeNETi22920
OpenTargetsiENSG00000075945
PharmGKBiPA30111

Polymorphism and mutation databases

BioMutaiKIFAP3
DMDMi73920216

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000843021 – 792Kinesin-associated protein 3Add BLAST792

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei60PhosphoserineCombined sources1

Post-translational modificationi

Phosphorylated on tyrosine residues by SRC in vitro; this reduces the binding affinity of the protein for RAP1GDS1.1 Publication

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ92845
MaxQBiQ92845
PaxDbiQ92845
PeptideAtlasiQ92845
PRIDEiQ92845
ProteomicsDBi75540

PTM databases

iPTMnetiQ92845
PhosphoSitePlusiQ92845

Expressioni

Gene expression databases

BgeeiENSG00000075945 Expressed in 222 organ(s), highest expression level in superior frontal gyrus
CleanExiHS_KIFAP3
GenevisibleiQ92845 HS

Organism-specific databases

HPAiHPA023738
HPA023742

Interactioni

Subunit structurei

Heterotrimer of KIFAP3, KIF3A and KIF3B. Interacts with RAP1GDS1/SMG GDS. Interacts with SMC3 subunit of the cohesin complex.2 Publications

Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

BioGridi116582, 74 interactors
ComplexPortaliCPX-3200 KIF3 complex variant AC-KAP3
CPX-3201 KIF3 complex variant AB-KAP3
IntActiQ92845, 64 interactors
MINTiQ92845
STRINGi9606.ENSP00000354560

Structurei

3D structure databases

ProteinModelPortaliQ92845
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Repeati333 – 373ARM 1Add BLAST41
Repeati374 – 412ARM 2Add BLAST39
Repeati494 – 533ARM 3Add BLAST40
Repeati578 – 620ARM 4Add BLAST43
Repeati621 – 662ARM 5Add BLAST42

Keywords - Domaini

Repeat

Phylogenomic databases

eggNOGiKOG1222 Eukaryota
ENOG410XT8I LUCA
GeneTreeiENSGT00390000003574
HOGENOMiHOG000012952
HOVERGENiHBG052257
InParanoidiQ92845
OMAiFMFKSNK
OrthoDBiEOG091G06I3
PhylomeDBiQ92845
TreeFamiTF314964

Family and domain databases

Gene3Di1.25.10.10, 2 hits
InterProiView protein in InterPro
IPR011989 ARM-like
IPR016024 ARM-type_fold
IPR000225 Armadillo
IPR008658 KAP3
PANTHERiPTHR15605 PTHR15605, 1 hit
SMARTiView protein in SMART
SM00185 ARM, 3 hits
SUPFAMiSSF48371 SSF48371, 1 hit
PROSITEiView protein in PROSITE
PS50176 ARM_REPEAT, 1 hit

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q92845-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MQGEDARYLK RKVKGGNIDV HPSEKALIVH YEVEATILGE MGDPMLGERK
60 70 80 90 100
ECQKIIRLKS LNANTDITSL ARKVVEECKL IHPSKLNEVE QLLYYLQNRR
110 120 130 140 150
DSLSGKEKKE KSSKPKDPPP FEGMEIDEVA NINDMDEYIE LLYEDIPDKV
160 170 180 190 200
RGSALILQLA RNPDNLEELL LNETALGALA RVLREDWKQS VELATNIIYI
210 220 230 240 250
FFCFSSFSQF HGLITHYKIG ALCMNIIDHE LKRHELWQEE LSKKKKAVDE
260 270 280 290 300
DPENQTLRKD YEKTFKKYQG LVVKQEQLLR VALYLLLNLA EDTRTELKMR
310 320 330 340 350
NKNIVHMLVK ALDRDNFELL ILVVSFLKKL SIFMENKNDM VEMDIVEKLV
360 370 380 390 400
KMIPCEHEDL LNITLRLLLN LSFDTGLRNK MVQVGLLPKL TALLGNDNYK
410 420 430 440 450
QIAMCVLYHI SMDDRFKSMF AYTDCIPQLM KMLFECSDER IDLELISFCI
460 470 480 490 500
NLAANKRNVQ LICEGNGLKM LMKRALKFKD PLLMKMIRNI SQHDGPTKNL
510 520 530 540 550
FIDYVGDLAA QISNDEEEEF VIECLGTLAN LTIPDLDWEL VLKEYKLVPY
560 570 580 590 600
LKDKLKPGAA EDDLVLEVVI MIGTVSMDDS CAALLAKSGI IPALIELLNA
610 620 630 640 650
QQEDDEFVCQ IIYVFYQMVF HQATRDVIIK ETQAPAYLID LMHDKNNEIR
660 670 680 690 700
KVCDNTLDII AEYDEEWAKK IQSEKFRWHN SQWLEMVESR QMDESEQYLY
710 720 730 740 750
GDDRIEPYIH EGDILERPDL FYNSDGLIAS EGAISPDFFN DYHLQNGDVV
760 770 780 790
GQHSFPGSLG MDGFGQPVGI LGRPATAYGF RPDEPYYYGY GS
Length:792
Mass (Da):91,205
Last modified:August 30, 2005 - v2
Checksum:i1887A75D811DF56A
GO
Isoform 2 (identifier: Q92845-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     11-55: RKVKGGNIDVHPSEKALIVHYEVEATILGEMGDPMLGERKECQKI → S

Note: No experimental confirmation available.
Show »
Length:748
Mass (Da):86,290
Checksum:i7183BDA516248AC4
GO
Isoform 3 (identifier: Q92845-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-40: Missing.

Note: No experimental confirmation available.
Show »
Length:752
Mass (Da):86,728
Checksum:i65A2E06360616022
GO
Isoform 4 (identifier: Q92845-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-106: MQGEDARYLK...QNRRDSLSGK → MSIALGNTYRRSLSDSETVSVLQASLCE

Show »
Length:714
Mass (Da):82,144
Checksum:iCF12D8DEF30AF92B
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti91Q → L in AAC50788 (PubMed:8900189).Curated1
Sequence conflicti734I → V in BAH13889 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_051081513S → A. Corresponds to variant dbSNP:rs12075833Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0471321 – 106MQGED…SLSGK → MSIALGNTYRRSLSDSETVS VLQASLCE in isoform 4. 1 PublicationAdd BLAST106
Alternative sequenceiVSP_0471331 – 40Missing in isoform 3. CuratedAdd BLAST40
Alternative sequenceiVSP_04450511 – 55RKVKG…ECQKI → S in isoform 2. 1 PublicationAdd BLAST45

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U59919 mRNA Translation: AAC50788.1
AK297368 mRNA Translation: BAH12562.1
AK303052 mRNA Translation: BAH13889.1
AK315586 mRNA Translation: BAG37958.1
AL356475 Genomic DNA No translation available.
AL121714 Genomic DNA No translation available.
CH471067 Genomic DNA Translation: EAW90872.1
CH471067 Genomic DNA Translation: EAW90873.1
CH471067 Genomic DNA Translation: EAW90871.1
BC028679 mRNA Translation: AAH28679.1
CCDSiCCDS1288.1 [Q92845-1]
CCDS55659.1 [Q92845-4]
CCDS55660.1 [Q92845-3]
CCDS55661.1 [Q92845-2]
RefSeqiNP_001191443.1, NM_001204514.1 [Q92845-4]
NP_001191445.1, NM_001204516.1 [Q92845-2]
NP_001191446.1, NM_001204517.1 [Q92845-3]
NP_055785.2, NM_014970.3 [Q92845-1]
UniGeneiHs.433442

Genome annotation databases

EnsembliENST00000361580; ENSP00000354560; ENSG00000075945 [Q92845-1]
ENST00000367765; ENSP00000356739; ENSG00000075945 [Q92845-3]
ENST00000367767; ENSP00000356741; ENSG00000075945 [Q92845-2]
ENST00000538366; ENSP00000444622; ENSG00000075945 [Q92845-4]
GeneIDi22920
KEGGihsa:22920
UCSCiuc001ggv.4 human [Q92845-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U59919 mRNA Translation: AAC50788.1
AK297368 mRNA Translation: BAH12562.1
AK303052 mRNA Translation: BAH13889.1
AK315586 mRNA Translation: BAG37958.1
AL356475 Genomic DNA No translation available.
AL121714 Genomic DNA No translation available.
CH471067 Genomic DNA Translation: EAW90872.1
CH471067 Genomic DNA Translation: EAW90873.1
CH471067 Genomic DNA Translation: EAW90871.1
BC028679 mRNA Translation: AAH28679.1
CCDSiCCDS1288.1 [Q92845-1]
CCDS55659.1 [Q92845-4]
CCDS55660.1 [Q92845-3]
CCDS55661.1 [Q92845-2]
RefSeqiNP_001191443.1, NM_001204514.1 [Q92845-4]
NP_001191445.1, NM_001204516.1 [Q92845-2]
NP_001191446.1, NM_001204517.1 [Q92845-3]
NP_055785.2, NM_014970.3 [Q92845-1]
UniGeneiHs.433442

3D structure databases

ProteinModelPortaliQ92845
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi116582, 74 interactors
ComplexPortaliCPX-3200 KIF3 complex variant AC-KAP3
CPX-3201 KIF3 complex variant AB-KAP3
IntActiQ92845, 64 interactors
MINTiQ92845
STRINGi9606.ENSP00000354560

PTM databases

iPTMnetiQ92845
PhosphoSitePlusiQ92845

Polymorphism and mutation databases

BioMutaiKIFAP3
DMDMi73920216

Proteomic databases

EPDiQ92845
MaxQBiQ92845
PaxDbiQ92845
PeptideAtlasiQ92845
PRIDEiQ92845
ProteomicsDBi75540

Protocols and materials databases

DNASUi22920
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000361580; ENSP00000354560; ENSG00000075945 [Q92845-1]
ENST00000367765; ENSP00000356739; ENSG00000075945 [Q92845-3]
ENST00000367767; ENSP00000356741; ENSG00000075945 [Q92845-2]
ENST00000538366; ENSP00000444622; ENSG00000075945 [Q92845-4]
GeneIDi22920
KEGGihsa:22920
UCSCiuc001ggv.4 human [Q92845-1]

Organism-specific databases

CTDi22920
DisGeNETi22920
EuPathDBiHostDB:ENSG00000075945.12
GeneCardsiKIFAP3
HGNCiHGNC:17060 KIFAP3
HPAiHPA023738
HPA023742
MIMi601836 gene
neXtProtiNX_Q92845
OpenTargetsiENSG00000075945
PharmGKBiPA30111
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG1222 Eukaryota
ENOG410XT8I LUCA
GeneTreeiENSGT00390000003574
HOGENOMiHOG000012952
HOVERGENiHBG052257
InParanoidiQ92845
OMAiFMFKSNK
OrthoDBiEOG091G06I3
PhylomeDBiQ92845
TreeFamiTF314964

Enzyme and pathway databases

ReactomeiR-HSA-1445148 Translocation of SLC2A4 (GLUT4) to the plasma membrane
R-HSA-2132295 MHC class II antigen presentation
R-HSA-5620924 Intraflagellar transport
R-HSA-6811434 COPI-dependent Golgi-to-ER retrograde traffic
R-HSA-983189 Kinesins
SignaLinkiQ92845

Miscellaneous databases

ChiTaRSiKIFAP3 human
GeneWikiiKIFAP3
GenomeRNAii22920
PROiPR:Q92845
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000075945 Expressed in 222 organ(s), highest expression level in superior frontal gyrus
CleanExiHS_KIFAP3
GenevisibleiQ92845 HS

Family and domain databases

Gene3Di1.25.10.10, 2 hits
InterProiView protein in InterPro
IPR011989 ARM-like
IPR016024 ARM-type_fold
IPR000225 Armadillo
IPR008658 KAP3
PANTHERiPTHR15605 PTHR15605, 1 hit
SMARTiView protein in SMART
SM00185 ARM, 3 hits
SUPFAMiSSF48371 SSF48371, 1 hit
PROSITEiView protein in PROSITE
PS50176 ARM_REPEAT, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiKIFA3_HUMAN
AccessioniPrimary (citable) accession number: Q92845
Secondary accession number(s): B1AKU4
, B1AKU5, B2RDL1, B7Z8A3, F5H591, Q8NHU7, Q9H416
Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 10, 2002
Last sequence update: August 30, 2005
Last modified: November 7, 2018
This is version 159 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again