Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 172 (26 Feb 2020)
Sequence version 4 (26 Feb 2008)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Type II iodothyronine deiodinase

Gene

DIO2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Responsible for the deiodination of T4 (3,5,3',5'-tetraiodothyronine) into T3 (3,5,3'-triiodothyronine). Essential for providing the brain with appropriate levels of T3 during the critical period of development.

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei1331

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionOxidoreductase
Biological processThyroid hormones biosynthesis

Enzyme and pathway databases

BioCyc Collection of Pathway/Genome Databases

More...
BioCyci
MetaCyc:HS00008-MONOMER

BRENDA Comprehensive Enzyme Information System

More...
BRENDAi
1.97.1.10 2681

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-350864 Regulation of thyroid hormone activity

SABIO-RK: Biochemical Reaction Kinetics Database

More...
SABIO-RKi
Q92813

SIGNOR Signaling Network Open Resource

More...
SIGNORi
Q92813

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Type II iodothyronine deiodinase (EC:1.21.99.4)
Alternative name(s):
5DII
DIOII
Type 2 DI
Type-II 5'-deiodinase
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:DIO2
Synonyms:ITDI2, TXDI2
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 14

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:2884 DIO2

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
601413 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q92813

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei10 – 34HelicalSequence analysisAdd BLAST25

Keywords - Cellular componenti

Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
1734

Open Targets

More...
OpenTargetsi
ENSG00000211448

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA27338

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q92813 Tbio

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...
ChEMBLi
CHEMBL3542431

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
DIO2

Domain mapping of disease mutations (DMDM)

More...
DMDMi
172045839

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001543171 – 273Type II iodothyronine deiodinaseAdd BLAST273

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Ubiquitinated by MARCHF6, leading to its degradation by the proteasome. Deubiquitinated by USP20 and USP33.2 Publications

Keywords - PTMi

Ubl conjugation

Proteomic databases

PeptideAtlas

More...
PeptideAtlasi
Q92813

PRoteomics IDEntifications database

More...
PRIDEi
Q92813

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
32803
75492 [Q92813-1]
75493 [Q92813-2]

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Isoform 1 is expressed in the lung, trachea, kidney, heart, skeletal muscle, placenta, fetal brain and several regions of the adult brain (PubMed:8755651, PubMed:11165050). Isoform 2 is expressed in the brain, heart, kidney and trachea (PubMed:11165050).2 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000211448 Expressed in uterine cervix and 191 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q92813 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q92813 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA029544
HPA048002

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with USP20 and USP33.

Interacts with MARCHF6.

2 Publications

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
108078, 15 interactors

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q92813 protein

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the iodothyronine deiodinase family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IXX0 Eukaryota
ENOG4111SVE LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000154482

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_089345_1_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q92813

KEGG Orthology (KO)

More...
KOi
K17904

Database of Orthologous Groups

More...
OrthoDBi
977776at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q92813

TreeFam database of animal gene trees

More...
TreeFami
TF329721

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
3.40.30.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR000643 Iodothyronine_deiodinase
IPR008261 Iodothyronine_deiodinase_AS
IPR036249 Thioredoxin-like_sf

The PANTHER Classification System

More...
PANTHERi
PTHR11781 PTHR11781, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00837 T4_deiodinase, 1 hit

PIRSF; a whole-protein classification database

More...
PIRSFi
PIRSF001330 IOD, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF52833 SSF52833, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS01205 T4_DEIODINASE, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 6 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q92813-1) [UniParc]FASTAAdd to basket
Also known as: hDII-a

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MGILSVDLLI TLQILPVFFS NCLFLALYDS VILLKHVVLL LSRSKSTRGE
60 70 80 90 100
WRRMLTSEGL RCVWKSFLLD AYKQVKLGED APNSSVVHVS STEGGDNSGN
110 120 130 140 150
GTQEKIAEGA TCHLLDFASP ERPLVVNFGS ATUPPFTSQL PAFRKLVEEF
160 170 180 190 200
SSVADFLLVY IDEAHPSDGW AIPGDSSLSF EVKKHQNQED RCAAAQQLLE
210 220 230 240 250
RFSLPPQCRV VADRMDNNAN IAYGVAFERV CIVQRQKIAY LGGKGPFSYN
260 270
LQEVRHWLEK NFSKRUKKTR LAG
Length:273
Mass (Da):30,552
Last modified:February 26, 2008 - v4
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i88D68B9AA6CB2A42
GO
Isoform 2 (identifier: Q92813-2) [UniParc]FASTAAdd to basket
Also known as: hDII-b

The sequence of this isoform differs from the canonical sequence as follows:
     74-74: Q → QLNCPPSGFSKDGHILCLVYEAYKSRLLVYSHLDLWM

Note: Has a Sec in positions 90, 169 and 302.Curated
Show »
Length:309
Mass (Da):34,704
Checksum:i9D9FC1EA33A4E5FB
GO
Isoform 3 (identifier: Q92813-3) [UniParc]FASTAAdd to basket
Also known as: hDII-c

The sequence of this isoform differs from the canonical sequence as follows:
     1-53: Missing.
     75-146: VKLGEDAPNS...TSQLPAFRKL → LNCPPSGFSK...YIVSKKEKVP
     147-273: Missing.

Note: Has a Sec in position 37.Curated
Show »
Length:93
Mass (Da):10,666
Checksum:iB92C930836C1702A
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 6 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
G3V3A8G3V3A8_HUMAN
Iodothyronine deiodinase
DIO2
54Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A024R6J8A0A024R6J8_HUMAN
Iodothyronine deiodinase
DIO2 hCG_20551
89Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
J3KQY5J3KQY5_HUMAN
Iodothyronine deiodinase
DIO2
145Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
G3V2A7G3V2A7_HUMAN
Type II iodothyronine deiodinase
DIO2
56Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YJ42H0YJ42_HUMAN
Type II iodothyronine deiodinase
DIO2
37Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YJQ8H0YJQ8_HUMAN
Type II iodothyronine deiodinase
DIO2
58Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAC95470 differs from that shown. Reason: Erroneous initiation. Extended N-terminus.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti198L → P in BAB16838 (PubMed:11165050).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_04964081A → D. Corresponds to variant dbSNP:rs2839859Ensembl.1
Natural variantiVAR_04754992T → A. Corresponds to variant dbSNP:rs225014Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0600281 – 53Missing in isoform 3. Add BLAST53
Alternative sequenceiVSP_02615474Q → QLNCPPSGFSKDGHILCLVY EAYKSRLLVYSHLDLWM in isoform 2. 1 Publication1
Alternative sequenceiVSP_06002975 – 146VKLGE…AFRKL → LNCPPSGFSKDGHILULVYE AYKSRLLVYSHLDLWMTDSV VLTLNFPRQISLCFGKNSAA ELYIVSKKEKVP in isoform 3. Add BLAST72
Alternative sequenceiVSP_060030147 – 273Missing in isoform 3. Add BLAST127

Non-standard residue

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the occurrence of non-standard amino acids selenocysteine (Sec) or pyrrolysine (Pyl) in the protein sequence.<p><a href='/help/non_std' target='_top'>More...</a></p>Non-standard residuei133Selenocysteine1
Non-standard residuei266Selenocysteine1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
U53506 mRNA Translation: AAC50663.1
AF093774 mRNA Translation: AAC95470.1 Different initiation.
AB041843 mRNA Translation: BAB16838.1
AB041844 mRNA Translation: BAB16839.1
AC007372 Genomic DNA Translation: AAD45494.1
AC010849 Genomic DNA No translation available.
AL049837 Genomic DNA No translation available.
BC074882 mRNA Translation: AAH74882.1
BC136514 mRNA Translation: AAI36515.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS45146.1 [Q92813-1]

NCBI Reference Sequences

More...
RefSeqi
NP_000784.2, NM_000793.5
NP_001007024.1, NM_001007023.4
NP_001229431.1, NM_001242502.2
NP_001229432.1, NM_001242503.2
NP_001311391.1, NM_001324462.1
NP_054644.1, NM_013989.4 [Q92813-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000438257; ENSP00000405854; ENSG00000211448 [Q92813-1]
ENST00000557010; ENSP00000451419; ENSG00000211448 [Q92813-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
1734

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:1734

UCSC genome browser

More...
UCSCi
uc010asy.4 human [Q92813-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism, Selenocysteine

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross%5Freferences%5Fsection">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

Atlas of Genetics and Cytogenetics in Oncology and Haematology

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U53506 mRNA Translation: AAC50663.1
AF093774 mRNA Translation: AAC95470.1 Different initiation.
AB041843 mRNA Translation: BAB16838.1
AB041844 mRNA Translation: BAB16839.1
AC007372 Genomic DNA Translation: AAD45494.1
AC010849 Genomic DNA No translation available.
AL049837 Genomic DNA No translation available.
BC074882 mRNA Translation: AAH74882.1
BC136514 mRNA Translation: AAI36515.1
CCDSiCCDS45146.1 [Q92813-1]
RefSeqiNP_000784.2, NM_000793.5
NP_001007024.1, NM_001007023.4
NP_001229431.1, NM_001242502.2
NP_001229432.1, NM_001242503.2
NP_001311391.1, NM_001324462.1
NP_054644.1, NM_013989.4 [Q92813-1]

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

BioGridi108078, 15 interactors

Chemistry databases

ChEMBLiCHEMBL3542431

Polymorphism and mutation databases

BioMutaiDIO2
DMDMi172045839

Proteomic databases

PeptideAtlasiQ92813
PRIDEiQ92813
ProteomicsDBi32803
75492 [Q92813-1]
75493 [Q92813-2]

Genome annotation databases

EnsembliENST00000438257; ENSP00000405854; ENSG00000211448 [Q92813-1]
ENST00000557010; ENSP00000451419; ENSG00000211448 [Q92813-1]
GeneIDi1734
KEGGihsa:1734
UCSCiuc010asy.4 human [Q92813-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
1734
DisGeNETi1734

GeneCards: human genes, protein and diseases

More...
GeneCardsi
DIO2
HGNCiHGNC:2884 DIO2
HPAiHPA029544
HPA048002
MIMi601413 gene
neXtProtiNX_Q92813
OpenTargetsiENSG00000211448
PharmGKBiPA27338

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410IXX0 Eukaryota
ENOG4111SVE LUCA
GeneTreeiENSGT00940000154482
HOGENOMiCLU_089345_1_0_1
InParanoidiQ92813
KOiK17904
OrthoDBi977776at2759
PhylomeDBiQ92813
TreeFamiTF329721

Enzyme and pathway databases

BioCyciMetaCyc:HS00008-MONOMER
BRENDAi1.97.1.10 2681
ReactomeiR-HSA-350864 Regulation of thyroid hormone activity
SABIO-RKiQ92813
SIGNORiQ92813

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
DIO2 human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
DIO2

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
1734
PharosiQ92813 Tbio

Protein Ontology

More...
PROi
PR:Q92813
RNActiQ92813 protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000211448 Expressed in uterine cervix and 191 other tissues
ExpressionAtlasiQ92813 baseline and differential
GenevisibleiQ92813 HS

Family and domain databases

Gene3Di3.40.30.10, 1 hit
InterProiView protein in InterPro
IPR000643 Iodothyronine_deiodinase
IPR008261 Iodothyronine_deiodinase_AS
IPR036249 Thioredoxin-like_sf
PANTHERiPTHR11781 PTHR11781, 1 hit
PfamiView protein in Pfam
PF00837 T4_deiodinase, 1 hit
PIRSFiPIRSF001330 IOD, 1 hit
SUPFAMiSSF52833 SSF52833, 1 hit
PROSITEiView protein in PROSITE
PS01205 T4_DEIODINASE, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiIOD2_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q92813
Secondary accession number(s): B9EGK0
, G3V315, Q6B0A3, Q9HCP7, Q9HCP8, Q9P1W4, Q9UDZ1
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: February 26, 2008
Last modified: February 26, 2020
This is version 172 of the entry and version 4 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 14
    Human chromosome 14: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again