Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Symplekin

Gene

SYMPK

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Scaffold protein that functions as a component of a multimolecular complex involved in histone mRNA 3'-end processing. Specific component of the tight junction (TJ) plaque, but might not be an exclusively junctional component. May have a house-keeping rule. Is involved in pre-mRNA polyadenylation. Enhances SSU72 phosphatase activity.2 Publications

Miscellaneous

Could be used as a differentiation marker in the differential diagnosis of tumors.

GO - Biological processi

Keywordsi

Biological processCell adhesion, mRNA processing

Enzyme and pathway databases

ReactomeiR-HSA-109688 Cleavage of Growing Transcript in the Termination Region
R-HSA-159231 Transport of Mature mRNA Derived from an Intronless Transcript
R-HSA-72163 mRNA Splicing - Major Pathway
R-HSA-72187 mRNA 3'-end processing
R-HSA-77595 Processing of Intronless Pre-mRNAs

Names & Taxonomyi

Protein namesi
Recommended name:
Symplekin
Gene namesi
Name:SYMPK
Synonyms:SPK
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 19

Organism-specific databases

EuPathDBiHostDB:ENSG00000125755.18
HGNCiHGNC:22935 SYMPK
MIMi602388 gene
neXtProtiNX_Q92797

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell junction, Cell membrane, Cytoplasm, Cytoskeleton, Membrane, Nucleus, Tight junction

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi185K → A: Abolishes stimulation of SSU72 phosphatase activity. 1 Publication1

Organism-specific databases

DisGeNETi8189
OpenTargetsiENSG00000125755
PharmGKBiPA134896920

Polymorphism and mutation databases

BioMutaiSYMPK
DMDMi71153180

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000723851 – 1274SymplekinAdd BLAST1274

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei13PhosphoserineCombined sources1
Cross-linki361Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO1); alternateCombined sources
Cross-linki361Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2); alternateCombined sources
Cross-linki483Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Modified residuei494PhosphoserineCombined sources1
Modified residuei1221PhosphoserineCombined sources1
Modified residuei1222PhosphoserineCombined sources1
Cross-linki1239Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO1)Combined sources
Modified residuei1243PhosphoserineCombined sources1
Modified residuei1257PhosphothreonineCombined sources1
Modified residuei1259PhosphoserineCombined sources1

Keywords - PTMi

Isopeptide bond, Phosphoprotein, Ubl conjugation

Proteomic databases

EPDiQ92797
MaxQBiQ92797
PaxDbiQ92797
PeptideAtlasiQ92797
PRIDEiQ92797
ProteomicsDBi75477
75478 [Q92797-2]

PTM databases

iPTMnetiQ92797
PhosphoSitePlusiQ92797

Expressioni

Tissue specificityi

In testis, expressed in polar epithelia and Sertoli cells but not in vascular endothelia. The protein is detected in stomach, duodenum, pancreas, liver, fetal brain, carcinomas, lens-forming cells, fibroblasts, lymphocytes, lymphoma cells, erythroleukemia cells but not in endothelium of vessels, epidermis, intercalated disks, Purkinje fiber cells of the heart and lymph node.1 Publication

Gene expression databases

BgeeiENSG00000125755 Expressed in 198 organ(s), highest expression level in testis
CleanExiHS_SYMPK
ExpressionAtlasiQ92797 baseline and differential
GenevisibleiQ92797 HS

Organism-specific databases

HPAiHPA041756
HPA042449

Interactioni

Subunit structurei

Found in a heat-sensitive complex at least composed of several cleavage and polyadenylation specific and cleavage stimulation factors (PubMed:16230528). Interacts with CPSF2, CPSF3 and CSTF2 (PubMed:10669729, PubMed:18688255). Interacts (via N-terminus) with HSF1; this interaction is direct and occurs upon heat shock (PubMed:14707147). Interacts with SSU72 (PubMed:20861839, PubMed:23070812).6 Publications

Binary interactionsi

Protein-protein interaction databases

BioGridi113833, 93 interactors
CORUMiQ92797
DIPiDIP-42506N
IntActiQ92797, 35 interactors
MINTiQ92797
STRINGi9606.ENSP00000245934

Structurei

Secondary structure

11274
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

ProteinModelPortaliQ92797
SMRiQ92797
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ92797

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Repeati31 – 64HEAT 1Add BLAST34
Repeati67 – 101HEAT 2Add BLAST35
Repeati104 – 146HEAT 3Add BLAST43
Repeati153 – 192HEAT 4Add BLAST40
Repeati227 – 266HEAT 5Add BLAST40

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni1 – 124Interaction with HSF11 PublicationAdd BLAST124

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Motifi345 – 360Nuclear localization signalSequence analysisAdd BLAST16

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi1168 – 1175Poly-Ser8

Domaini

The HEAT repeats have been determined based on 3D-structure analysis of the D.melanogaster ortholog and are not detected by sequence-based prediction programs.

Sequence similaritiesi

Belongs to the Symplekin family.Curated

Keywords - Domaini

Repeat

Phylogenomic databases

eggNOGiKOG1895 Eukaryota
ENOG410XQAS LUCA
GeneTreeiENSGT00390000017045
HOGENOMiHOG000046745
HOVERGENiHBG062441
InParanoidiQ92797
KOiK06100
OMAiLQGFTRH
OrthoDBiEOG091G02S0
PhylomeDBiQ92797
TreeFamiTF312860

Family and domain databases

Gene3Di1.25.10.10, 1 hit
InterProiView protein in InterPro
IPR011989 ARM-like
IPR016024 ARM-type_fold
IPR021850 Symplekin/Pta1
IPR032460 Symplekin/Pta1_N
IPR022075 Symplekin_C
PANTHERiPTHR15245:SF20 PTHR15245:SF20, 1 hit
PfamiView protein in Pfam
PF11935 DUF3453, 1 hit
PF12295 Symplekin_C, 1 hit
SUPFAMiSSF48371 SSF48371, 1 hit

Sequences (2+)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket
Note: Additional isoforms seem to exist.

This entry has 2 described isoforms and 7 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q92797-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MASGSGDSVT RRSVASQFFT QEEGPGIDGM TTSERVVDLL NQAALITNDS
60 70 80 90 100
KITVLKQVQE LIINKDPTLL DNFLDEIIAF QADKSIEVRK FVIGFIEEAC
110 120 130 140 150
KRDIELLLKL IANLNMLLRD ENVNVVKKAI LTMTQLYKVA LQWMVKSRVI
160 170 180 190 200
SELQEACWDM VSAMAGDIIL LLDSDNDGIR THAIKFVEGL IVTLSPRMAD
210 220 230 240 250
SEIPRRQEHD ISLDRIPRDH PYIQYNVLWE EGKAALEQLL KFMVHPAISS
260 270 280 290 300
INLTTALGSL ANIARQRPMF MSEVIQAYET LHANLPPTLA KSQVSSVRKN
310 320 330 340 350
LKLHLLSVLK HPASLEFQAQ ITTLLVDLGT PQAEIARNMP SSKDTRKRPR
360 370 380 390 400
DDSDSTLKKM KLEPNLGEDD EDKDLEPGPS GTSKASAQIS GQSDTDITAE
410 420 430 440 450
FLQPLLTPDN VANLVLISMV YLPEAMPASF QAIYTPVESA GTEAQIKHLA
460 470 480 490 500
RLMATQMTAA GLGPGVEQTK QCKEEPKEEK VVKTESVLIK RRLSAQGQAI
510 520 530 540 550
SVVGSLSSMS PLEEEAPQAK RRPEPIIPVT QPRLAGAGGR KKIFRLSDVL
560 570 580 590 600
KPLTDAQVEA MKLGAVKRIL RAEKAVACSG AAQVRIKILA SLVTQFNSGL
610 620 630 640 650
KAEVLSFILE DVRARLDLAF AWLYQEYNAY LAAGASGSLD KYEDCLIRLL
660 670 680 690 700
SGLQEKPDQK DGIFTKVVLE APLITESALE VVRKYCEDES RTYLGMSTLR
710 720 730 740 750
DLIFKRPSRQ FQYLHVLLDL SSHEKDKVRS QALLFIKRMY EKEQLREYVE
760 770 780 790 800
KFALNYLQLL VHPNPPSVLF GADKDTEVAA PWTEETVKQC LYLYLALLPQ
810 820 830 840 850
NHKLIHELAA VYTEAIADIK RTVLRVIEQP IRGMGMNSPE LLLLVENCPK
860 870 880 890 900
GAETLVTRCL HSLTDKVPPS PELVKRVRDL YHKRLPDVRF LIPVLNGLEK
910 920 930 940 950
KEVIQALPKL IKLNPIVVKE VFNRLLGTQH GEGNSALSPL NPGELLIALH
960 970 980 990 1000
NIDSVKCDMK SIIKATNLCF AERNVYTSEV LAVVMQQLME QSPLPMLLMR
1010 1020 1030 1040 1050
TVIQSLTMYP RLGGFVMNIL SRLIMKQVWK YPKVWEGFIK CCQRTKPQSF
1060 1070 1080 1090 1100
QVILQLPPQQ LGAVFDKCPE LREPLLAHVR SFTPHQQAHI PNSIMTILEA
1110 1120 1130 1140 1150
SGKQEPEAKE APAGPLEEDD LEPLTLAPAP APRPPQDLIG LRLAQEKALK
1160 1170 1180 1190 1200
RQLEEEQKLK PGGVGAPSSS SPSPSPSARP GPPPSEEAMD FREEGPECET
1210 1220 1230 1240 1250
PGIFISMDDD SGLTEAALLD SSLEGPLPKE TAAGGLTLKE ERSPQTLAPV
1260 1270
GEDAMKTPSP AAEDAREPEA KGNS
Length:1,274
Mass (Da):141,148
Last modified:July 19, 2005 - v2
Checksum:iD8AD9ABB0B25A688
GO
Isoform 2 (identifier: Q92797-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     637-672: GSLDKYEDCLIRLLSGLQEKPDQKDGIFTKVVLEAP → PRLCWRRHSSQRVPWRWSASTARMRVAPIWACPHFET
     673-1274: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay. No experimental confirmation available.
Show »
Length:673
Mass (Da):74,523
Checksum:iE5939FC7FFDAA3AA
GO

Computationally mapped potential isoform sequencesi

There are 7 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A087WUE9A0A087WUE9_HUMAN
Symplekin
SYMPK
1,058Annotation score:
M0R3C7M0R3C7_HUMAN
Symplekin
SYMPK
673Annotation score:
M0R180M0R180_HUMAN
Symplekin
SYMPK
137Annotation score:
M0R033M0R033_HUMAN
Symplekin
SYMPK
95Annotation score:
M0R1C2M0R1C2_HUMAN
Symplekin
SYMPK
115Annotation score:
M0QXP5M0QXP5_HUMAN
Symplekin
SYMPK
142Annotation score:
M0R039M0R039_HUMAN
Symplekin
SYMPK
50Annotation score:

Sequence cautioni

The sequence AAC50667 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence AAH30214 differs from that shown. Contaminating sequence. Potential poly-A sequence.Curated
The sequence BAD92261 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated
The sequence CAA71861 differs from that shown. Reason: Frameshift at position 67.Curated

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_014842637 – 672GSLDK…VLEAP → PRLCWRRHSSQRVPWRWSAS TARMRVAPIWACPHFET in isoform 2. 1 PublicationAdd BLAST36
Alternative sequenceiVSP_014843673 – 1274Missing in isoform 2. 1 PublicationAdd BLAST602

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
Y10931 mRNA Translation: CAA71861.1 Frameshift.
AB209024 mRNA Translation: BAD92261.1 Different initiation.
U88726 mRNA Translation: AAB58578.1
BC006536 mRNA Translation: AAH06536.2
BC006567 mRNA Translation: AAH06567.2
BC030214 mRNA Translation: AAH30214.1 Sequence problems.
U49240 mRNA Translation: AAC50667.1 Different initiation.
DB328640 mRNA No translation available.
CCDSiCCDS12676.2 [Q92797-1]
RefSeqiNP_004810.2, NM_004819.2 [Q92797-1]
XP_005259343.1, XM_005259286.1 [Q92797-1]
XP_011525656.1, XM_011527354.1 [Q92797-1]
UniGeneiHs.515475

Genome annotation databases

EnsembliENST00000245934; ENSP00000245934; ENSG00000125755 [Q92797-1]
GeneIDi8189
KEGGihsa:8189
UCSCiuc002pdn.4 human [Q92797-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
Y10931 mRNA Translation: CAA71861.1 Frameshift.
AB209024 mRNA Translation: BAD92261.1 Different initiation.
U88726 mRNA Translation: AAB58578.1
BC006536 mRNA Translation: AAH06536.2
BC006567 mRNA Translation: AAH06567.2
BC030214 mRNA Translation: AAH30214.1 Sequence problems.
U49240 mRNA Translation: AAC50667.1 Different initiation.
DB328640 mRNA No translation available.
CCDSiCCDS12676.2 [Q92797-1]
RefSeqiNP_004810.2, NM_004819.2 [Q92797-1]
XP_005259343.1, XM_005259286.1 [Q92797-1]
XP_011525656.1, XM_011527354.1 [Q92797-1]
UniGeneiHs.515475

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
3O2QX-ray2.40A/D30-360[»]
3O2SX-ray2.50A30-360[»]
3O2TX-ray1.40A30-395[»]
3ODRX-ray2.20A1-395[»]
3ODSX-ray1.90A1-395[»]
4H3HX-ray2.20A/D30-360[»]
4H3KX-ray2.00A/D30-360[»]
ProteinModelPortaliQ92797
SMRiQ92797
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi113833, 93 interactors
CORUMiQ92797
DIPiDIP-42506N
IntActiQ92797, 35 interactors
MINTiQ92797
STRINGi9606.ENSP00000245934

PTM databases

iPTMnetiQ92797
PhosphoSitePlusiQ92797

Polymorphism and mutation databases

BioMutaiSYMPK
DMDMi71153180

Proteomic databases

EPDiQ92797
MaxQBiQ92797
PaxDbiQ92797
PeptideAtlasiQ92797
PRIDEiQ92797
ProteomicsDBi75477
75478 [Q92797-2]

Protocols and materials databases

DNASUi8189
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000245934; ENSP00000245934; ENSG00000125755 [Q92797-1]
GeneIDi8189
KEGGihsa:8189
UCSCiuc002pdn.4 human [Q92797-1]

Organism-specific databases

CTDi8189
DisGeNETi8189
EuPathDBiHostDB:ENSG00000125755.18
GeneCardsiSYMPK
H-InvDBiHIX0015243
HGNCiHGNC:22935 SYMPK
HPAiHPA041756
HPA042449
MIMi602388 gene
neXtProtiNX_Q92797
OpenTargetsiENSG00000125755
PharmGKBiPA134896920
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG1895 Eukaryota
ENOG410XQAS LUCA
GeneTreeiENSGT00390000017045
HOGENOMiHOG000046745
HOVERGENiHBG062441
InParanoidiQ92797
KOiK06100
OMAiLQGFTRH
OrthoDBiEOG091G02S0
PhylomeDBiQ92797
TreeFamiTF312860

Enzyme and pathway databases

ReactomeiR-HSA-109688 Cleavage of Growing Transcript in the Termination Region
R-HSA-159231 Transport of Mature mRNA Derived from an Intronless Transcript
R-HSA-72163 mRNA Splicing - Major Pathway
R-HSA-72187 mRNA 3'-end processing
R-HSA-77595 Processing of Intronless Pre-mRNAs

Miscellaneous databases

ChiTaRSiSYMPK human
EvolutionaryTraceiQ92797
GeneWikiiSYMPK
GenomeRNAii8189
PROiPR:Q92797
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000125755 Expressed in 198 organ(s), highest expression level in testis
CleanExiHS_SYMPK
ExpressionAtlasiQ92797 baseline and differential
GenevisibleiQ92797 HS

Family and domain databases

Gene3Di1.25.10.10, 1 hit
InterProiView protein in InterPro
IPR011989 ARM-like
IPR016024 ARM-type_fold
IPR021850 Symplekin/Pta1
IPR032460 Symplekin/Pta1_N
IPR022075 Symplekin_C
PANTHERiPTHR15245:SF20 PTHR15245:SF20, 1 hit
PfamiView protein in Pfam
PF11935 DUF3453, 1 hit
PF12295 Symplekin_C, 1 hit
SUPFAMiSSF48371 SSF48371, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiSYMPK_HUMAN
AccessioniPrimary (citable) accession number: Q92797
Secondary accession number(s): O00521
, O00689, O00733, Q59GT5, Q8N2U5
Entry historyiIntegrated into UniProtKB/Swiss-Prot: December 1, 2000
Last sequence update: July 19, 2005
Last modified: November 7, 2018
This is version 169 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. Human chromosome 19
    Human chromosome 19: entries, gene names and cross-references to MIM
  4. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again